Dbfetch

ID   X98056; SV 1; linear; mRNA; STD; MUS; 735 BP.
XX
AC   X98056;
XX
DT   27-MAY-1996 (Rel. 47, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   M.musculus mRNA for glutathione S-transferase, GSTT2
XX
KW   glutathione S-transferase theta; GSTT2 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 8761485.
RA   Mainwaring G.W., Williams S.M., Foster J.R., Tugwood J., Green T.;
RT   "The distribution of Theta-class glutathione S-transferases in the liver
RT   and lung of mouse, rat and human";
RL   Biochem. J. 318:297-303(1996).
XX
RN   [2]
RP   1-735
RA   Mainwaring G.W.;
RT   ;
RL   Submitted (20-MAY-1996) to the INSDC.
RL   G.W. Mainwaring, Zeneca Central Toxicology Laboratory, Alderley Park,
RL   Macclesfield, Cheshire, SK10 4TJ, UK
XX
DR   MD5; f0de3ff2a1fc514dc2d273923d18146f.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017367; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017344; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017305; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017304; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017128; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016699; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017100; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017205; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017198; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017278; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017226; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017801; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016482; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025792; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025769; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025732; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025734; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025544; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026230; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025586; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025587; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024819; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025084; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..735
FT                   /organism="Mus musculus"
FT                   /strain="B6C3F1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..735
FT                   /gene="GSTT2"
FT                   /product="glutathione S-transferase theta"
FT                   /EC_number="2.5.1.18"
FT                   /note="phase II conjugation enzyme"
FT                   /db_xref="GOA:Q61133"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:106188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61133"
FT                   /protein_id="CAA66666.1"
FT                   /translation="MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQF
FT                   SQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHAD
FT                   NIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVT
FT                   LADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAK
FT                   KMLPVPPPEVHASMQLRIARIP"
XX
SQ   Sequence 735 BP; 168 A; 200 C; 212 G; 155 T; 0 other;
     atgggtttgg agctctacct ggacctgctg tcacaaccca gccgcgctgt ctacatcttc        60
     gccaagaaga atggcatccc cttccagacg cgtaccgtgg atatactcaa agggcagcac       120
     atgagcgagc aattctccca ggtgaactgc ttaaacaaag ttcctgtact caaagacgga       180
     agcttcgtgt tgaccgaaag cacagccatc ttgatttacc tgagttccaa gtaccaggtg       240
     gcagaccact ggtacccggc cgacctacag gcccgtgccc aagtccacga atacctgggc       300
     tggcatgccg acaacatccg tggtactttc ggagtgctcc tatggaccaa ggtgttgggg       360
     ccactcattg gggtccaggt tccccaggag aaggtggaac ggaacagaga tagaatggtc       420
     ctggttctgc aacagctgga ggacaagttc ctcagggaca gggccttcct tgttggccag       480
     caggtgacgc tagcggatct catgtctctg gaggagttga tgcagcccgt ggctcttggc       540
     tataacctgt ttgagggacg gcctcagctg acagcatggc gagagagggt ggaggcgttc       600
     ttgggtgctg agctgtgtca ggaggctcat agcaccatcc tgagcatcct gggacaggca       660
     gccaagaaaa tgttaccagt accccctccg gaggtccatg ccagcatgca gcttcgaatt       720
     gccaggattc cctga                                                        735
//