spacer

EBI Dbfetch

ID   X97407; SV 1; linear; genomic DNA; STD; HUM; 248 BP.
XX
AC   X97407;
XX
DT   24-APR-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   H.sapiens DRB1 gene, exon 2
XX
KW   DRB1 gene; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-248
RA   Varney M.D.;
RT   ;
RL   Submitted (27-MAR-1996) to the INSDC.
RL   M.D. Varney, Royal Melbourne Hospital, Tissue Typing, Grattan Street,
RL   Parkville, Victoria 3050, AUSTRALIA
XX
RN   [3]
RP   1-248
RA   Varney M.D., Tait B.D.;
RT   "Identification of a novel DRB1 allele";
RL   Unpublished.
XX
RN   [4]
RP   1-248
RA   Varney M.D., Tait B.D.;
RT   "Identification of a novel DPB allele";
RL   Unpublished.
XX
DR   MD5; b2acd79f87e8c671e0e465af7a6bd137.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..248
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="du25503"
FT                   /mol_type="genomic DNA"
FT                   /note="a1,2;b7,b18"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>248
FT                   /codon_start=1
FT                   /gene="DRB1"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:28"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAA66060.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTE
FT                   LGRPDAEYWNSQKDILEDERAAVDTYCRHNYRVVESFT"
FT   exon            <1..>248
FT                   /number=2
XX
SQ   Sequence 248 BP; 54 A; 60 C; 88 G; 46 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gacagatact tccataacca ggaggagaac gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gccgagtact ggaacagcca gaaggacatc       180
     ctggaagacg agcgggccgc ggtggacacc tactgcagac acaactaccg ggttgtggag       240
     agcttcac                                                                248
//


spacer
spacer