Dbfetch

ID   X96639; SV 1; linear; mRNA; STD; MUS; 2965 BP.
XX
AC   X96639;
XX
DT   18-MAR-1996 (Rel. 47, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   M.musculus mRNA for protein responsible for hereditary multiple exostosis
XX
KW   ext1 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RA   Lin X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-2965
RA   Lin X.;
RT   ;
RL   Submitted (14-MAR-1996) to the INSDC.
RL   X. Lin, University of Houston, Dept. of Biology, Houston, Houston, TX,
RL   77204, USA
XX
DR   MD5; 6b82a372365dffd34e1a280ff777439c.
DR   Ensembl-Gn; ENSMUSG00000061731; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021843; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021803; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021784; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021810; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022249; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021101; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021553; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021677; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021655; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021747; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021679; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022272; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020846; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021156; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077273; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040935; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040895; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040864; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040894; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040629; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041361; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040687; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040546; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040697; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040660; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040767; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041408; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040279; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040030; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2965
FT                   /organism="Mus musculus"
FT                   /strain="c57 Black/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /dev_stage="16.5 d.p.c"
FT                   /db_xref="taxon:10090"
FT   CDS             595..2832
FT                   /gene="ext1"
FT                   /note="responsible for hereditary multiple exotosis"
FT                   /db_xref="GOA:P97464"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR015338"
FT                   /db_xref="InterPro:IPR027670"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:894663"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97464"
FT                   /protein_id="CAA65443.1"
FT                   /translation="MQAKKRYFILLSAGSSLALLFYFGGVQFRASRSHSRREEHSGRNG
FT                   LHQPSPDHFWPRFPEPLRPFFPWDQLENEDSSVHISPRQKRDANSSIYKGKKCRMESCF
FT                   DFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDR
FT                   DQLSPQYVHNLRSKVQSLHLWNNGRNHLIFNLYSGTWPDYTEDVGFDIGQAMLAKATIS
FT                   TENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRN
FT                   ALYHVHNGEDVLLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGR
FT                   RLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQD
FT                   KILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLPQY
FT                   SSYLGDFPYYYANLGLKPPSKFTAVIHPVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLW
FT                   NCDKPLPAKHRWPATAVPVIVIEGESKVMSRFLPYDNIITDAVLSLDEDTVLSTTEVDF
FT                   AFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYSH
FT                   YLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTSRASRWADP
FT                   DHFAQRQSCMNTFASWFGYMPLIHSQMRLDPVLFKDQVSILRKKYRDIERL"
XX
SQ   Sequence 2965 BP; 738 A; 747 C; 753 G; 727 T; 0 other;
     ggacacgagg tgtgggagcc gctgcagaag ggaataaaga gacatgcagg gatttgtgag        60
     gttacggcgc cccagctgca agatgcacta ggccggctga agccgggtgc ggattgactt       120
     gttggaaccg tagtgctctg caccggagtg tggatgagtt gaagttgctt tccccgggct       180
     cgttctccac gtccgccgag aggaatccga gcggagaggc agtcacttcg tcttgccatt       240
     gattgggtat cgggagcttt ttcttccctg ctctctttct tttcctccgt cttgttgcat       300
     gcaagaaaat tacagtccgc tgttcgcccg ccctgggtgc gagatcttct gcccggcctc       360
     tctcccgtgc attgtgcagc ccaaagatga aagaccgaaa gggagaagtt aaacaaatcg       420
     cccacatgcg ctggatcagt ccacggcttg gggaaaggca tccagagaag gtgggagcgg       480
     agagtttgaa gtctttacag gcgggaagat ggcggactgg agctgaaagt gttgattggg       540
     aaacttgggt gattcttgtg tttatttaca atcctcttga cccaggcagg acacatgcag       600
     gccaaaaaac gctatttcat cctgctctca gctggctctt ctctcgccct tttgttttat       660
     tttggaggcg tgcagtttag ggcatcgagg agccacagcc ggagagaaga gcacagtggt       720
     cggaatggct tgcaccagcc cagtccggat catttctggc cccgcttccc ggagcctctg       780
     cgccccttct ttccttggga tcaattggaa aacgaggatt ccagcgtgca catttccccc       840
     cggcagaagc gagacgccaa ctcgagcatc tacaaaggca agaagtgccg catggagtcc       900
     tgcttcgatt tcaccctttg caagaaaaac ggcttcaaag tctacgtgta cccgcagcag       960
     aaaggggaga aaatcgccga aagttaccaa aacattctag cggccatcga gggctccagg      1020
     ttctacacct cggaccccag ccaggcgtgc ctctttgtct tgagtctgga tactttagac      1080
     agagaccagt tatcacctca gtatgtgcac aatttgagat ccaaagtgca gagtctccac      1140
     ttgtggaaca atggtaggaa tcatttaatt tttaatttat attctggcac ttggcctgac      1200
     tacactgagg acgtggggtt tgacatcggc caggcgatgc tggccaaagc cacgatcagt      1260
     actgaaaact tccgaccaaa ctttgatgtt tctattcccc tcttttctaa ggatcatccc      1320
     aggacaggag gggagagggg gtttttgaaa tttaacacca tccctcctct caggaagtac      1380
     atgctggtat tcaaggggaa gcggtacctg acagggatag ggtcagacac caggaatgcc      1440
     ttatatcacg tccataacgg ggaggacgtc ttgctcctca ccacctgcaa gcatggcaaa      1500
     gactggcaaa agcacaagga ttctcgctgt gacagagaca acaccgagta tgagaaatat      1560
     gattatcggg aaatgctgca caatgccact ttctgtctgg ttcctcgtgg tcgcaggctt      1620
     gggtccttca gattcctgga ggctttgcag gctgcctgtg tccctgtaat gctcagcaac      1680
     ggatgggagt tgccattctc cgaagtgatt aattggaacc aagctgccgt cataggcgat      1740
     gagagattgc tattacagat tccttctaca atcaggtcta ttcatcagga taaaatccta      1800
     gcacttagac agcagacaca gttcttgtgg gaggcttatt tttcttcagt tgagaagatt      1860
     gtattaacta cactagagat tattcaggac agaatattca agcacatatc acgtaacagt      1920
     ttaatatgga acaaacatcc tggaggattg ttcgtcctac cgcagtattc atcttacctg      1980
     ggagatttcc cttactacta tgctaattta ggtttaaagc ccccctccaa attcactgca      2040
     gtcatccatc ctgtgactcc cctggtctct cagtcccagc cagtgttgaa gcttcttgtg      2100
     gctgcagcca aatcccagta ctgtgcgcag atcatagttc tgtggaattg tgacaagcct      2160
     ctaccagcca aacatcgctg gcctgccact gccgtgcctg tcatcgtcat tgaaggagaa      2220
     agcaaggtta tgagccggtt tctgccctat gacaacatca tcactgatgc tgtgctcagc      2280
     ctggatgagg acactgtgct ttcaactacg gaagtggatt ttgccttcac cgtatggcag      2340
     agcttcccag agaggattgt gggatatcct gctcgcagtc atttctggga taactcaaag      2400
     gagcggtggg gatatacatc caagtggacg aatgactact ccatggtgtt gacaggagct      2460
     gctatctacc acaaatatta tcactacctg tattcccatt acctgccagc cagcctgaag      2520
     aacatggtag accaactggc caactgtgag gacattctca tgaatttcct ggtgtctgct      2580
     gtgacaaaat tgcctccaat caaagtgacc cagaagaaac agtataagga gacaatgatg      2640
     ggacagactt cccgagcatc ccgctgggcc gaccctgacc actttgccca gcgacagagc      2700
     tgcatgaata catttgccag ctggtttggc tacatgccgc tgatccattc tcagatgagg      2760
     ctggacccgg tcctctttaa agaccaagtc tcaattctga ggaagaaata cagagacatt      2820
     gaacgacttt gaggaagccg accgagtggg ggaggggaag caagacgggc gtccagctgc      2880
     ttctctcctc cttcccaatg cagatccctc acgcccagca gtggagccag actgtgccaa      2940
     gtatcaaaaa atcaaaactc gtgcc                                            2965
//