spacer

EBI Dbfetch

ID   X96396; SV 1; linear; genomic DNA; STD; HUM; 242 BP.
XX
AC   X96396;
XX
DT   01-JUL-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 16)
XX
DE   H.sapiens MHC class II DR-beta gene, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1 protein; MHC class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1997.tb02718.x.
RX   PUBMED; 9027974.
RA   Voorter C.E.M., de Bruyn-Geraets D., Verduyn W., Schreuder G.M.T.,
RA   van den Berg-Loonen E.M.;
RT   "Identification of a new HLA-DRB1*13 allele (DRB1*1326) with a short
RT   DRB1*16 sequence";
RL   Tissue Antigens 49(1):88-91(1997).
XX
RN   [2]
RC   Revised by [3]
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (01-MAR-1996) to the INSDC.
RL   E. Van Den Berg-Loonen, Tissue Typing Lab,Univ. Hospital Maastricht,
RL   P.O.Box 5800, NL- 6202 AZ Maastricht, NETHERLANDS
XX
RN   [3]
RP   1-242
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (28-MAY-1996) to the INSDC.
RL   E. Van Den Berg-Loonen, Tissue Typing Lab,Univ. Hospital Maastricht,
RL   P.O.Box 5800, NL- 6202 AZ Maastricht, NETHERLANDS
XX
DR   MD5; d50e03b99780d84bc946e9bdf7ea17da.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..242
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="WIL/2"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>242
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DRB1"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:26:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAA65260.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTE
FT                   LGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGE"
FT   exon            <1..>242
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 242 BP; 53 A; 56 C; 89 G; 44 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gagagatact tccataacca ggaggagaac gtgcgcttcg acagcgacgt gggggagtac       120
     cgggcggtga cggagctggg gcggcctgac gctgagtact ggaacagcca gaaggacttc       180
     ctggaagaca ggcgcgccgc ggtggacacc tactgcagac acaactacgg ggttggtgag       240
     ag                                                                      242
//


spacer
spacer