spacer

EBI Dbfetch

ID   X95344; SV 1; linear; mRNA; STD; MUS; 567 BP.
XX
AC   X95344;
XX
DT   01-APR-1996 (Rel. 47, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   M.musculus mRNA for phospholipase C beta 1
XX
KW   phospholipase C-beta1.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 8687404.
RA   Dupond G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F.;
RT   "Phospholipase C in mouse oocytes: characterisation of beta and gamma
RT   isoforms and their possible involvement in sperm-induced Ca2+ spiking";
RL   Biochem. J. 316:583-591(1996).
XX
RN   [2]
RP   1-567
RA   Borgese F.;
RT   ;
RL   Submitted (23-JAN-1996) to the INSDC.
RL   F. Borgese, CEA/CNRS,  Laboratoire Jean Maetz, La Darse Station Marine du
RL   CEA, F-06230 Villefranche sur Mer, FRANCE
XX
DR   MD5; 7bed27baf2d847405627824d7547d1b8.
DR   Ensembl-Gn; ENSMUSG00000051177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070724; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..567
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="oocytes"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>567
FT                   /codon_start=2
FT                   /product="phospholipase C beta 1"
FT                   /db_xref="GOA:Q9Z1B3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR009535"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014815"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR016280"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR028400"
FT                   /db_xref="MGI:MGI:97613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1B3"
FT                   /protein_id="CAA64637.1"
FT                   /translation="CRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHK
FT                   SSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAG
FT                   SEAMATEEMSNLVNYIQPVKFESFEISKKINKSFEMSSFVETKGLEQLTKSPVEFVEYN
FT                   KMQLSRIYPKGTRVDSSNYMPQIFW"
XX
SQ   Sequence 567 BP; 180 A; 120 C; 135 G; 132 T; 0 other;
     ctgccgatta atctttggtg atgccctcct gatggaacca ctggaaaaat acccactgga        60
     atctggggta cctcttccaa gccctatgga tttaatgtat aaaatcttgg tgaaaaacaa       120
     gaagaagtcg cacaagtcgt cagagggaag tggtaagaag aagctttctg agcaagcttc       180
     caacacctac agcgactcct ccagtgtgtt cgagccttcg tctccaggag ctggggaagc       240
     agatacggag agtgatgacg atgacgacga cgatgactgt aaaaaatctt ccatggatga       300
     ggggacagct gggagcgaag ccatggccac agaggagatg tctaacctgg tgaactatat       360
     tcagcctgtc aagtttgagt cctttgaaat ttcaaaaaaa ataaataaaa gctttgaaat       420
     gtcttccttc gtggaaacca aaggacttga acaacttaca aagtctccgg tggaatttgt       480
     agaatacaac aagatgcaac ttagcaggat atatcccaag ggaacacgtg tggattcatc       540
     caactacatg ccccagatct tctggaa                                           567
//


spacer
spacer