Dbfetch

ID   X94908; SV 1; linear; genomic DNA; STD; MUS; 1125 BP.
XX
AC   X94908;
XX
DT   12-JAN-1996 (Rel. 46, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   M.musculus 5-HT1D gene for seroprotein receptor 1D
XX
KW   5-HT1D gene; serotonin 1D receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 8978753.
RA   Wurch T., Palmier C., Colpaert F.C., Pauwels P.J.;
RT   "Sequence and functional analysis of cloned guinea pig and rat serotonin
RT   5-HT1D receptors: common pharmacological features within the 5-HT1D
RT   receptor subfamily";
RL   J. Neurochem. 68(1):410-418(1997).
XX
RN   [2]
RP   1-1125
RA   Wurch T.;
RT   ;
RL   Submitted (10-JAN-1996) to the INSDC.
RL   T. Wurch, Laboratory of Cellular and Molecular, Neurobiology, Centre de
RL   Recherche Pierre Fabre, 17, Av.Jean Moulin, F-81106 Castres Cedex, FRANCE
XX
DR   MD5; fc3d2227f4226558c5ddc51bf23474c5.
DR   Ensembl-Gn; ENSMUSG00000070687; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028966; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028925; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028877; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028949; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028663; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029390; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028095; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028777; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028744; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028876; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028770; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029428; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027815; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028173; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000088677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121571; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068693; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0068744; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0068653; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068667; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068335; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069157; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068803; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068279; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0068416; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068322; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0068513; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068329; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069341; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068301; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067521; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1125
FT                   /organism="Mus musculus"
FT                   /strain="NMRI"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1125
FT                   /gene="5-HT1D"
FT                   /product="serotonin 1D receptor"
FT                   /db_xref="GOA:Q61224"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000505"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96276"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61224"
FT                   /protein_id="CAA64395.1"
FT                   /translation="MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSVI
FT                   TLATVLSNAFVLTTILLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFG
FT                   QILCDIWVSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWIIS
FT                   ICISIPPLFWRQATAHEEMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAAR
FT                   SRILNPPSLYGKRFTTAQLITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADS
FT                   ILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTW
FT                   LGYLNSLINPVIYTVFNEDFRQAFQKVVHFRKAS"
XX
SQ   Sequence 1125 BP; 227 A; 375 C; 240 G; 283 T; 0 other;
     atgtcgctgc caaaccagtc cctagaaggc cttcctcagg aggcctccaa cagatccctg        60
     aatgcgacag gggcttggga cccagaggtc ctgcaggctc tcagaatctc gctcgtggtg       120
     gtgctgtccg tcatcacact ggccactgtc ctctccaatg cctttgtcct taccaccatt       180
     ctactcacca agaagctcca caccccagcc aattatctca ttggctcctt ggccaccacg       240
     gacctcctgg tttctatctt ggtcatgccc atcagcatag cctacaccac cacccgcacc       300
     tggaactttg gccagatcct gtgtgacatc tgggtgtctt ctgacatcac gtgctgcacg       360
     gcctccatct tgcatctctg tgtcattgct ctggacagat actgggccat caccgatgcc       420
     ctggagtaca gcaagcgtcg aaccgcaggc cacgcagcag ccatgattgc ggccgtctgg       480
     atcatctcta tttgtatctc catccctccg ctcttctggc ggcaggccac ggctcacgag       540
     gagatgtccg actgcctggt gaacacatct cagatttctt acaccatcta ctcgacctgt       600
     ggcgccttct atatcccatc catcttgctc attatcctgt atggccgcat atacgtggcc       660
     gcccggagtc gaatcctgaa cccaccctcc ctctacggga agcgcttcac cacggcacag       720
     cttatcacag gctctgctgg ctcttcgctc tgctcgctca accccagcct ccacgagagc       780
     cacacacaca cagttggctc ccctctcttt ttcaaccagg tgaaaatcaa gcttgctgat       840
     agcatcctag aacgcaagag gatctctgca gcccgagaaa ggaaagccac taagaccctg       900
     ggcatcattc tgggggcctt tatcatctgc tggttgcctt tctttgtagt atcgttggtc       960
     ctccccatct gcagggactc ctgttggatc cacccggccc tctttgactt cttcacgtgg      1020
     ctaggttatt taaactctct cattaacccc gtcatctaca ctgtgttcaa cgaagacttt      1080
     cgacaagcgt ttcagaaagt cgtccatttc cgaaaggcct cttag                      1125
//