spacer

EBI Dbfetch

ID   X91813; SV 1; linear; mRNA; STD; MUS; 2024 BP.
XX
AC   X91813;
XX
DT   04-OCT-1995 (Rel. 45, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   M.musculus mRNa for opioid-like receptor
XX
KW   opioid-like receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 8794880.
RA   Matthes H.W.D., Seward E.P., North R.A., Kieffer B.;
RT   "Functional selectivity of orphanin FQ for its receptor coexpressed with
RT   potassium channel subunits in Xenopus laevis oocytes";
RL   Mol. Pharmacol. 50(3):447-450(1996).
XX
RN   [2]
RP   1-2024
RA   Matthes H.W.D.;
RT   ;
RL   Submitted (26-SEP-1995) to the INSDC.
RL   H.W.D. Matthes, ESBS, UPR 9050, CNRS, Boulevard Sebastien Brandt, F-67400
RL   Illkirch, FRANCE
XX
DR   MD5; e96cb21c417762242ec18dc1bd6189a8.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2024
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="region H map units"
FT                   /strain="H.S Dawley"
FT                   /mol_type="mRNA"
FT                   /dev_stage="newborn"
FT                   /clone_lib="lambda ZAP II"
FT                   /clone="ORN7"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             179..1282
FT                   /product="Opioid-like receptor"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="CAA62922.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
XX
SQ   Sequence 2024 BP; 398 A; 543 C; 525 G; 558 T; 0 other;
     ggcacgagag ccattcccag ccggagcaga ccccaagcta gagtgagaag cattactcag        60
     ttcattgtgc tcctgcctgc ctttctgcta agcattaggg tctgttttgg cccagcttct       120
     gaagaggttg tgtgtgctgt tggaggaact gtactgagtg gctttgcagg gtgacagcat       180
     ggagtccctc tttcctgccc cattctggga ggtcttgtat ggcagccact ttcaagggaa       240
     cctgtctctc ctaaatgaga ccgtacccca tcacctgctc ctcaatgcta gccacagtgc       300
     cttcctgccc cttggactca aggtcaccat cgtggggctc tacttggctg tgtgcatcgg       360
     ggggctcctg gggaactgcc tcgtcatgta tgtcatcctc aggcacacca agatgaagac       420
     tgctaccaac atttacatat ttaatctggc actggctgat accctggtct tgctgacact       480
     gcccttccag ggcacagaca tccttctggg cttctggcca tttgggaatg cactgtgcaa       540
     gacggtcatt gctatcgact actacaacat gtttaccagc actttcactt tgactgccat       600
     gagtgtagac cgttatgtag ctatctgcca ccctatccgt gcccttgatg ttcggacatc       660
     cagtaaagcc caggccgtta atgtggccat atgggccctg gcttcggtgg ttggtgttcc       720
     tgttgccatc atgggctcag cacaagtgga ggatgaagag atcgagtgcc tggtggagat       780
     ccccgcccct caggactatt ggggccctgt atttgccatc tgcatcttcc ttttttcctt       840
     catcatcccg gttctgatca tctctgtctg ctacagcctc atgattcgac gacttcgtgg       900
     tgtccggctg ctttcaggct cccgagagaa ggaccggaac ctgcgacgca tcacacggct       960
     ggtactggta gttgtggctg tgtttgtggg ctgctggaca cctgtgcagg tctttgtcct      1020
     ggttcaagga ctgggtgttc agccaggtag tgagactgca gtagccattc tgcgcttctg      1080
     cacagccctg ggctatgtca acagttgtct caatcccatt ctctatgctt tcttggatga      1140
     gaacttcaag gcctgcttta gaaagttctg ctgtgcttct gccctgcacc gggagatgca      1200
     ggtttctgat cgtgtgcgca gcattgccaa ggatgtaggc cttggttgca agacctctga      1260
     gacagtacca cggccggcat gactaggcgt ggacctgccc atggtgcctg tcagtccaca      1320
     gagcccatct acacccaaca cggagctcac acaggtcact gctctctagg ttgaccctga      1380
     actgagcgtc tggggccttg aatggctttt cttttggttc aggatgctca gtcctagagg      1440
     aagacctttt agcaccatgg gacaggtcaa agcatcaagg tggcctccat ggcctctgtc      1500
     agattaagtt tcctccctgg tataggacca gagagaacca aaggaactgc atggaaacat      1560
     ccacaactca gtggacatgc ctggtgaacc catgtaggta ttcatggttc acttgactct      1620
     tctctggttt ctccctgctg ccctggttct aggtgggctc agcctgaggt attgtagttg      1680
     tcatgtagtc actattgtga ctacctgttg tgtgctattg ccctcagcct ttcagtgttt      1740
     gcacagaact ggtgatcata cccagtgttg cctggcccat aagcttggag ttgccttgga      1800
     gcatctagtt ctgactccac tgatgcattc agattacctg aggtgggtga gcatcagtgg      1860
     gttcttggat gactgtttcc tgacgattct tttcatgctg tactatggag tatatgaagg      1920
     ggacttcaca cttcatctgg tactgccact gcctgctcta ccaacctgga ccaccttctc      1980
     agcaagaggc tagcaggggg acaagacaca aagcttcctc gtgc                       2024
//


spacer
spacer