Dbfetch

ID   X83933; SV 1; linear; mRNA; STD; MUS; 3859 BP.
XX
AC   X83933;
XX
DT   23-JAN-1995 (Rel. 42, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 7)
XX
DE   M.musculus mRNA for ryanodine receptor type 2
XX
KW   ryanodine receptor; RYR2 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1083/jcb.128.5.893.
RX   PUBMED; 7876312.
RA   Giannini G., Conti A., Mammarella S., Scrobogna M., Sorrentino V.;
RT   "The ryanodine receptor/calcium channel genes are widely and differentially
RT   expressed in murine brain and peripheral tissues";
RL   J. Cell Biol. 128(5):893-904(1995).
XX
RN   [2]
RP   1-3859
RA   Sorrentino V.;
RT   ;
RL   Submitted (05-JAN-1995) to the INSDC.
RL   V. Sorrentino, DIBIT, San Raffaele Scientific Inst., via Olgettina 58,
RL   I-20132, Milano, ITALY
XX
DR   MD5; 91aa01b420afa9069764a2e74bdef3aa.
DR   Ensembl-Gn; ENSMUSG00000021313; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020227; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020183; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020158; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020166; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019970; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020613; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019508; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019937; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020054; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020039; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020128; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020075; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020641; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019271; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019568; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000021750; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036301; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0036224; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0036195; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036227; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035991; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036710; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035931; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0035902; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0036047; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0036027; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0036185; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036035; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036747; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035600; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035439; mus_musculus_wsbeij.
XX
CC   Sequence overlapping with that under the accession number X78667
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3859
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /map="A1-A2"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /clone_lib="MB3"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2470
FT                   /codon_start=2
FT                   /gene="RYR2"
FT                   /product="ryanodine receptor type 2"
FT                   /db_xref="GOA:E9Q401"
FT                   /db_xref="InterPro:IPR000699"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003032"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR009460"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013333"
FT                   /db_xref="InterPro:IPR013662"
FT                   /db_xref="InterPro:IPR014821"
FT                   /db_xref="InterPro:IPR015925"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="MGI:MGI:99685"
FT                   /db_xref="PDB:2MC2"
FT                   /db_xref="PDB:3IM5"
FT                   /db_xref="PDB:3IM6"
FT                   /db_xref="PDB:3IM7"
FT                   /db_xref="PDB:3QR5"
FT                   /db_xref="PDB:4ETV"
FT                   /db_xref="PDB:4KEI"
FT                   /db_xref="PDB:4KEJ"
FT                   /db_xref="PDB:4KEK"
FT                   /db_xref="PDB:4L4H"
FT                   /db_xref="PDB:4L4I"
FT                   /db_xref="PDB:4P9I"
FT                   /db_xref="PDB:4P9L"
FT                   /db_xref="PDB:5C33"
FT                   /db_xref="UniProtKB/Swiss-Prot:E9Q401"
FT                   /protein_id="CAA58785.1"
FT                   /translation="ERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFV
FT                   NFCEDTIFEMQLAAQISESDLNERLANKEESEKERPEEQAPRMGFFSLLTIQSALFALR
FT                   YNVLTLVRMLSLKSLKKQMKRMKKMTVKDMVLAFFSSYWSVFVTLLHFVASVCRGFFRI
FT                   VSSLLLGGSLVEGAKKTKVAELLANMPDPTQDEVRGDEEEGERKPLESALPSEDLTDLK
FT                   ELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMTNPVPVPEVQEKFQEQKAKE
FT                   EKEEKEETKSEPEKAEGEDGEKEEKAKDEKSKQKLRQLHTHRYGEPEVPESAFWKKIIA
FT                   YQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRTSSDTAKVT
FT                   NSLDSSPHRIIAVHYVLEESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKRE
FT                   KEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYG
FT                   RDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLY
FT                   LAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYL
FT                   YTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEY
FT                   EIYRIIFDITFFFFEIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYF
FT                   DTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDC
FT                   FRKQYEDQLN"
XX
SQ   Sequence 3859 BP; 1086 A; 865 C; 878 G; 1030 T; 0 other;
     cgaaagggtc tattttgaga tcagcgaatc cagccgaacc cagtgggaga aaccccaggt        60
     taaggagtcc aagaggcagt tcatattcga tgtggtcaat gagggcgggg agaaggagaa       120
     gatggagctc tttgtgaact tctgtgagga caccatcttt gagatgcagt tggcagctca       180
     gatctcagag tctgatctga atgagaggtt ggctaataaa gaagagagtg agaaggagag       240
     gccagaggag caggccccac gaatgggctt cttctccctc ctcaccatcc agtcagccct       300
     gtttgctctc aggtacaatg tcctaaccct cgtgaggatg ctcagcctga agagcctgaa       360
     gaagcagatg aagaggatga agaagatgac agtgaaggac atggtcttgg ccttcttctc       420
     atcctactgg agtgtgtttg tcaccctctt gcacttcgtg gccagtgtct gcaggggctt       480
     ctttcgcatt gtctccagcc tgttgctggg gggcagcctg gtggaaggtg ctaagaaaac       540
     taaagtggca gaacttctag ctaacatgcc agaccccact caggatgagg tgcgaggaga       600
     tgaagaggag ggagagagga agcctttaga gtcagccctg ccctctgaag acctgacaga       660
     cttgaaggaa ctgacagagg agagtgatct tctttctgac atattcggct tggatctgaa       720
     gagagaagga gggcagtaca aactaattcc tcacaaccca aatgccggcc tcagtgacct       780
     catgaccaac cctgtccctg tccctgaggt acaagaaaag tttcaggagc agaaggcgaa       840
     agaggaaaag gaagaaaagg aagaaaccaa gtcggaacca gagaaagctg aaggggagga       900
     tggagaaaaa gaagaaaaag ccaaagatga gaagagcaaa cagaagttga ggcagcttca       960
     tacacatcgc tatggggagc cggaagtgcc tgagtcagca ttctggaaga aaatcatagc      1020
     ctaccaacag aagctgctga actattttgc tcgcaacttt tacaacatga gaatgctggc      1080
     cttgtttgtt gccttcgcca tcaatttcat cctgctcttc tacaaggtct ccacttcttc      1140
     tgtggttgaa ggaaaggagc tgcctacccg aacctccagc gatactgcta aagtgaccaa      1200
     cagcctagac agcagccccc acaggatcat tgcggttcac tatgtcctgg aggagagcag      1260
     cggctacatg gaacccaccc tgcgcatctt agccatcctc cacaccatca tctccttctt      1320
     ttgcatcatc ggatactact gcttgaaagt ccccttggtt atttttaagc gagagaagga      1380
     agtggcccgg aagttggagt ttgacggact ttatataaca gagcagccat cggaagatga      1440
     tatcaaaggc cagtgggaca gacttgtgat caacacacag tcatttccca ataactactg      1500
     ggataaattt gtgaaaagaa aggtaatgga taaatatgga gagttttatg ggagagacag      1560
     aatcagtgag ttactgggca tggataaggc tgcactagat ttcagcgatg caagagagaa      1620
     gaagaagccc aagaaagaca gctccttgtc tgctgtattg aattctattg acgtgaagta      1680
     ccagatgtgg aaacttggag tcgtgttcac agacaattcc ttcctctacc tagcctggta      1740
     catgaccatg tctgttcttg gacattataa caactttttt tttgctgctc acctccttga      1800
     catcgcgatg ggattcaaga ccttgagaac tatcctgtcc tcagttaccc ataatggcaa      1860
     acagctcgtg ttaactgttg gcttattggc tgttgttgtg tacctgtaca ctgtcgtggc      1920
     gttcaatttc ttccgaaaat tctacaataa aagtgaggat ggtgacacgc cagacatgaa      1980
     gtgtgatgac atgctgacgt gttacatgtt ccacatgtat gtgggcgtcc gtgctggagg      2040
     gggcattggt gatgaaattg aagacccagc aggagacgag tatgagatct accgcatcat      2100
     ctttgacatc acattcttct tcttcgagat tgtcatcctt ttggctatca tacaaggttt      2160
     gatcattgat gcttttggag aactcagaga ccaacaagag caagtcaagg aagacatgga      2220
     gaccaagtgc ttcatctgtg ggattggcaa cgattatttt gatacagtgc cacatggctt      2280
     tgaaacccat actttacagg aacacaacct ggccaactac ctgttttttc tgatgtatct      2340
     cataaacaag gatgaaacag aacacacagg acaggaatct tacgtctgga agatgtacca      2400
     agagaggtgt tgggaatttt tcccagcagg ggactgtttc cggaaacagt atgaagacca      2460
     gttaaattag catcatacct tgattgtctc tgaaaaccaa aagcaatctc tctctcaatc      2520
     tctctctctc tctactcagt ctctcctctc tctctctctc tctctctccc cccccccccc      2580
     cccctccctc cctctccccc ccccaccttg gaaatcgacc tactcatatt ttccactaac      2640
     cagcatcttg tgctgatgtc acggatgctc agtctcagag gacctgactg ttctcccccc      2700
     acctcatgta tcttcattga gaaacaaaga ccgaagaaca atcaaataag cattcagact      2760
     aaccaggaac tctggaaagg agaattccat catggatact ctaccataac acccatggac      2820
     agcttcccct gaagggtcat ggagtctcca caagctgcca gacctgtgca gccaagcacg      2880
     gcagtcacac tcacccaggc tctttatttt gccatcccag aaggaagtgt ctgagggtca      2940
     tagagcactg tagcacttaa caggttgcca tgcaaaggga aatagtgcct tactataagt      3000
     gggttgagct atgcagaaga taatgtgcat gacaaacacc tttatttttc tttacatcaa      3060
     ccttgttttc ttagataaaa tggttttgtg attttggttt ctttcttttt tctccccttt      3120
     tattcttttc tttggtggag gagggtaaga aaagctatct gcgctatttt caaaagaagg      3180
     gtggtgtgtc tcaggacaga aggaggctct tgtcatccag ctacgtcaca tttaccctcc      3240
     ccactttggt aaagactctg atgctacatg gcaacttatg aaatctttgt atgaaaaaag      3300
     agactgcaaa aatacaactt tcaaaagaaa taattcattg catgtttatt atgcaagttt      3360
     aaatgaacaa agaaagccct cagaaacaag ttgatccaca tgggagaact ttcgtgataa      3420
     ttacatccgt agtaacaaag ctgtgggctt cctcatattt ctggagtcag tgtcatccac      3480
     cgacagttgg aaccatcgcc aatgtgacag tagtcttggg ttttcctctt tcttttggcc      3540
     acctgtgatc agtcattggt taaggaccct tgacaggcca tcttttgata tccaacgtga      3600
     agcaatatcc attcagagat ttcattggtt gcatcataag acatgggtga ccatgtacat      3660
     cgattcattt ttatgttttt cttttttctt ttctttttat cattttgagt ccttttaaat      3720
     gtaattctaa tctttacaat taaaaaaaga caggttcaga atggaagcga ggtcattctg      3780
     cgaacattgg agatctttta ttacaagtct gcttgttaat tttagaattg taaaacggct      3840
     ctaattaaac tatttaatc                                                   3859
//