Dbfetch

ID   X82205; SV 1; linear; mRNA; STD; MUS; 485 BP.
XX
AC   X82205;
XX
DT   20-OCT-1994 (Rel. 41, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   M.musculus mRNA for collagen type IV alpha3 chain
XX
KW   collagen alpha 3 type IV.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RA   Oberbaeumer I.;
RT   "Cloning of the NC1 domains fo the minor collagen IV chains of mouse via
RT   PCR (RACE) reveals the presence of the mRNAs for alpha3 (IV) and alpha5
RT   (IV) in differentiated teratocarcinoma cells";
RL   Unpublished.
XX
RN   [2]
RP   1-485
RA   Oberbaeumer I.;
RT   ;
RL   Submitted (13-OCT-1994) to the INSDC.
RL   I. Oberbaeumer, Max-Planck-Institut fuer Biochemie, 82152 Martinsried, FRG
XX
DR   MD5; 154dfb561a9515f16d0c460d8c3a45ac.
DR   Ensembl-Gn; ENSMUSG00000079465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113457; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..485
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="mRNA"
FT                   /clone_lib="PCR from cDNA"
FT                   /cell_line="PYS-2  /11"
FT                   /cell_type="epithelial"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>485
FT                   /codon_start=3
FT                   /gene="col4a3"
FT                   /product="collagen type IV alpha3 chain"
FT                   /db_xref="GOA:Q9QZS0"
FT                   /db_xref="InterPro:IPR001442"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:104688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZS0"
FT                   /protein_id="CAA57689.1"
FT                   /translation="SCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPI
FT                   SGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAR
FT                   QALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKA"
FT   primer_bind     1..22
FT                   /note="human sequence (oligo)"
FT   primer_bind     462..485
FT                   /note="human sequence (oligo)"
XX
SQ   Sequence 485 BP; 125 A; 126 C; 102 G; 132 T; 0 other;
     gcagctgcct gcagcgattt accacaatgc cgttcttatt ctgtaacatc aataatgtat        60
     gtaactttgc atcacgaaat gattattcat actggctgtc aacaccagct ctgatgccaa       120
     tggacatggc tccaattagt ggcagagctc tcgaacccta tattagcaga tgcaccgtct       180
     gtgaaggtcc agcaatggcc atagctgttc acagtcaaac tactgctatc cctccgtgtc       240
     cccaggactg ggtttctctc tggaaaggtt tttctttcat tatgttcaca agtgcaggct       300
     ctgagggtgc tagacaagca cttgcctcgc ctggctcctg cctggaagaa ttccgagcca       360
     gtccatttat agaatgccat ggacgaggga catgtaacta ctactcaaac tcctacagtt       420
     tctggctggc ttcgctgaac ccagaaagaa tgttcagaaa acctattcca tcaactgtga       480
     aagct                                                                   485
//