spacer

EBI Dbfetch

ID   X81580; SV 1; linear; mRNA; STD; MUS; 1310 BP.
XX
AC   X81580;
XX
DT   26-SEP-1994 (Rel. 41, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   M.musculus mRNA for insulin-like growth factor binding protein-2
XX
KW   IGFBP-2 gene; insulin-like growth factor binding protein 2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1016/0303-7207(94)90051-5.
RX   PUBMED; 7529732.
RA   Schuller A.G.P., Groffen C., Van Neck J.W., Zwarthoff E.C., Drop S.L.S.;
RT   "cDNA cloning and mRNA expression of the six mouse insulin-like growth
RT   factor binding proteins";
RL   Mol. Cell. Endocrinol. 104(1):57-66(1994).
XX
RN   [2]
RP   1-1310
RA   Van Neck J.W.;
RT   ;
RL   Submitted (07-SEP-1994) to the INSDC.
RL   J.W. Van Neck, Lab for Molecular Endocrinology, Dept of Pediatrics, Room
RL   1022, Erasmus University, PO Box 1738, 3000 Dr Rotterdam, NETHERLANDS
XX
DR   MD5; 064955b8f021095b3ff5bb7d7bec6c80.
DR   Ensembl-Gn; ENSMUSG00000039323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047328; mus_musculus.
DR   EuropePMC; PMC1316955; 16314510.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1310
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt11, Promega"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             72..989
FT                   /gene="IGFBP-2"
FT                   /product="insulin-like growth factor binding protein-2"
FT                   /db_xref="GOA:P47877"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR012210"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR022321"
FT                   /db_xref="MGI:MGI:96437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47877"
FT                   /protein_id="CAA57270.1"
FT                   /translation="MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTP
FT                   EALAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELP
FT                   LKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLK
FT                   SGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMR
FT                   LPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIR
FT                   GDPECHLFYNEQQETGGAHAQSVQ"
FT   regulatory      1292..1297
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1310 BP; 271 A; 402 C; 404 G; 233 T; 0 other;
     cgtctcccgc attcgtctgg gccgtgcacc tgcccgctag ctcgctgcac taccgttgcc        60
     cacaagccaa catgctgccg agattgggcg gccccgcgct gccgctgctc ctgccgtcgt       120
     tgctcttgct gctgctcttg ggcgcgggcg gctgcggccc cggggtgcgc gccgaggtgc       180
     tgttccgctg cccaccctgc acgcccgagg ctctggccgc ttgcgggccc ccacccgacg       240
     cgccctgcgc cgagctggtg cgagagcccg gctgcggctg ctgctccgtg tgcgcacggc       300
     aggagggcga agcatgcggc gtctacatcc cgcgctgcgc ccagacgcta cgctgctatc       360
     ccaacccggg ctccgagctg cccctgaagg cgcttgtcac aggcgcgggt acctgtgaaa       420
     agagacgcgt gggcaccacc ccacagcagg ttgcagacag tgatgacgac cactctgagg       480
     gaggcctggt ggagaaccac gtggatggga ccatgaacat gttgggaggt ggtagcagtg       540
     ctggccggaa gcccctcaag tcaggcatga aggagctggc tgtgttccgg gagaaggtca       600
     atgaacagca ccggcagatg ggcaagggtg ccaaacacct cagtctggag gagcccaaga       660
     agttgcgccc gcctcccgcc aggacccctt gccagcagga gttggaccag gtcctggagc       720
     ggatctccac catgcgcctt ccggatgatc ggggccccct ggaacatctc tactccctgc       780
     acatccccaa ctgtgacaag catggccggt acaaccttaa gcagtgcaag atgtctctga       840
     acggacagcg cggggagtgc tggtgtgtga accccaatac cgggaagccc atccagggag       900
     ctcccaccat ccggggagac cccgagtgcc atctcttcta caacgagcag caggagactg       960
     gtggggccca tgcccaaagt gtgcagtaaa ccccagccag tcggtgcctg gcttccccat      1020
     cccgaacacc agcagaaatg gagggcgtca gggtgacggg tgtggaggag ttcccagttt      1080
     tgacacatgt atttatattg gaaagagacc aacactgagc tcagaagccc ccctctgacc      1140
     ccccccagcg gctgttaact gaacctccct tgcttctgtt agagagggga agggtggtat      1200
     ggagggcact gggtacaggc ctgggaatgg ggaaagaaat ttttattttt gaatccctgt      1260
     gtctctttta cttaagatta aaggaaggaa aaataaaaaa aaaaaaaaaa                 1310
//


spacer
spacer