spacer

EBI Dbfetch

ID   X80992; SV 1; linear; mRNA; STD; MUS; 2402 BP.
XX
AC   X80992;
XX
DT   10-AUG-1994 (Rel. 40, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   M.musculus Vgr-1 mRNA
XX
KW   vgr gene; Vgr-1 protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1083/jcb.126.6.1595.
RX   PUBMED; 8089189.
RA   Gitelman S.E., Kobrin M.S., Ye J.Q., Lopez A.R., Lee A., Derynck R.;
RT   "Recombinant Vgr-1/BMP-6-expressing tumors induce fibrosis and endochondral
RT   bone formation in vivo";
RL   J. Cell Biol. 126(6):1595-1609(1994).
XX
RN   [2]
RP   1-2402
RA   Gitelman S.E.;
RT   ;
RL   Submitted (07-AUG-1994) to the INSDC.
RL   S.E. Gitelman, University of California at San Francisco, Box 0136,
RL   Millberry Union East, Rm405, San Francisco,  CA94143, USA
XX
DR   MD5; b57d5e42bc014c2ead5a823e3801ab5e.
DR   Ensembl-Gn; ENSMUSG00000039004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171970; mus_musculus.
DR   EuropePMC; PMC2290953; 8089189.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2402
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="8.5 day post coitum"
FT                   /tissue_type="whole embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             217..1749
FT                   /gene="Vgr-1"
FT                   /product="Vg-1 related protein"
FT                   /db_xref="GOA:P20722"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR002405"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88182"
FT                   /protein_id="CAA56917.1"
FT                   /translation="MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAG
FT                   GSPVRAEQPPPQSSSSGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQPPVL
FT                   PPQQQQQQQQQQTAREEPPPGRLKSAPLFMLDLYNALSNDDEEDGASEGVGQEPGSHGG
FT                   ASSSQLRQPSPGAAHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDADMVMSFVNLVEYD
FT                   KEFSPHQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQ
FT                   HRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRA
FT                   AGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSD
FT                   YNGSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIV
FT                   QTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH"
XX
SQ   Sequence 2402 BP; 490 A; 718 C; 717 G; 477 T; 0 other;
     gatcctggcg gtcgcggcgt cgtctcttct ccacccgggc ttctgggccc cccgcggatg        60
     accatgagag ataaggactg agtgccagaa ccgggaagag agcccgccga gaggtggcgg       120
     gggctgccca ctccgagggc acagcctccg cgctccggcc tcgctccgcc gctcgacgcc       180
     tcgcgggccc cgcgggggca gccgggctgg gcggcgatgc ccgggctggg gcggagggcg       240
     cagtggctgt gctggtggtg ggggttgctg tgcagctgcg gccccccgcc actgcggccc       300
     cctctgccgg tagccgcggc cgccgccggg gggcagctgc tgggagccgg cgggagcccg       360
     gtgcgcgctg agcagccacc gccacagtcc tcttcttcgg gcttcctcta tcggcggctc       420
     aagacccacg agaagcggga gatgcaaaag gagatcctgt cggtgctggg gctcccgcac       480
     aggccgcggc ccctgcacgg tctccagcag cctcagcccc cggtgctccc gccacagcag       540
     cagcagcagc agcagcagca gcagacggcc cgcgaggagc cccctccagg gcggctgaag       600
     tccgctccac tcttcatgct ggatctctac aacgccctgt ccaatgacga cgaagaggat       660
     ggggcatcgg agggtgtggg gcaagagcct gggtcccacg gaggggccag ctcgtcccag       720
     ctcaggcagc cgtctcccgg cgctgcacac tccttgaacc gcaagagtct cctggccccg       780
     ggacccggtg gcggtgcgtc cccactgact agcgcgcagg acagcgcttt cctcaacgac       840
     gcggacatgg tcatgagctt tgtgaacctg gtggagtacg acaaggagtt ctccccacat       900
     caacgacacc acaaagagtt caagttcaac ctatcccaga ttcctgaggg tgaggcggtg       960
     acggctgctg agttccgcgt ctacaaggac tgtgtggtgg ggagttttaa aaaccaaacc      1020
     tttcttatca gcatttacca agtcttgcag gagcatcagc acagagactc tgacctattt      1080
     ttgttggaca cccgggtggt gtgggcctca gaagaaggtt ggctggaatt tgacatcaca      1140
     gcaactagca atctgtgggt ggtgacaccg cagcacaaca tggggctcca gctgagtgtg      1200
     gtgactcggg atggactcca cgtcaacccc cgtgcggcgg gcctggtggg cagagacggc      1260
     ccttacgaca agcagccctt catggtggcc ttcttcaagg tgagcgaggt ccacgtgcgc      1320
     accaccaggt cagcctccag tcggcggcgg cagcagagtc gcaaccggtc cacccagtcg      1380
     caggacgtgt cccggggctc cggttcttca gactacaacg gcagtgagtt aaaaacagct      1440
     tgcaagaagc atgagctcta tgtgagcttc caggacctgg gatggcagga ctggatcatt      1500
     gcacccaaag gctacgctgc caactactgt gatggagagt gttccttccc actcaacgca      1560
     cacatgaatg ccaccaacca cgccattgta cagaccttgg tccaccttat gaatcccgag      1620
     tacgtcccca aaccatgctg cgcaccaacc aaactgaatg ccatctcggt tctttacttc      1680
     gatgataact ccaatgtcat cttgaaaaag tacaggaata tggtcgtgag agcttgtggt      1740
     tgccattaag ttgaagctgg tgtgtgtgtg tgggtggggg catggttctg ccttggattc      1800
     ctaacaacaa catctgcctt aaaccacgaa caacagcaca gcgaagcggg atggtgacac      1860
     acagagggat cgtgacacgc agacacatct cccgctggtg ccttacccac ggaggctttt      1920
     atgaggacct tgtcaagggc tttcccagtt cctaactgag cagttgctgg tctgcaggaa      1980
     gctggaaggc ttgtagtaca ggcctggaaa ctgcagttac ctaatgttcg cctcccccaa      2040
     ccccgcccgg agtagtttta gcttttagat ctagctgctt gtggtgtaag taaacttgaa      2100
     ggaatattaa atatccctgg gttgaaagac ccggtggtgg ctctacagca cccatcccag      2160
     ggagattttt gcagacatcc gaatggaggg gagaagggca ctctttcagg ttccattccc      2220
     agcaagggca gctcacacag gacctgcagc ctggccatca gcaggctctg tggaggtgcc      2280
     ttctgtctac tgttgtagtt acgtgttttg tgttgactct cggtggtgtg agaatgtact      2340
     aatctctgtc aagacaaact gtagcatttc caccccatcc tcctccctcc ctcacagaat      2400
     tc                                                                     2402
//


spacer
spacer