Dbfetch

ID   X80021; SV 1; linear; genomic DNA; STD; HUM; 2181 BP.
XX
AC   X80021;
XX
DT   09-FEB-1995 (Rel. 42, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   H.sapiens p75 TNF receptor, exon 1
XX
KW   p75 tumor necrosis factor receptor; tumor necrosis factor receptor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1016/0378-1119(94)90457-X.
RX   PUBMED; 7821811.
RA   Kuhnert P., Kemper O., Wallach D.;
RT   "Cloning, sequencing and partial functional characterization of the 5'
RT   region of the human p75 tumor necrosis factor receptor-encoding gene
RT   (TNF-R)";
RL   Gene 150(2):381-386(1994).
XX
RN   [2]
RP   1-2181
RA   Wallach D.;
RT   ;
RL   Submitted (04-JUL-1994) to the INSDC.
RL   D. Wallach, Weizmann Institute of Science, Dept of Membrane Research &
RL   Biophysics, Rehovot, 76100, ISRAEL
XX
DR   MD5; ad5cd6d27d6eabf0ad358803e19d6b94.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2181
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="p36"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Stratagene nr. 943202"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(2005..2171,X80022.1:1795..>1827)
FT   exon            2005..2171
FT                   /number=1
FT   CDS             join(2094..2171,X80022.1:1795..>1827)
FT                   /product="p75 TNF receptor"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LBF2"
FT                   /protein_id="CAA56324.1"
FT                   /translation="MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPG"
FT   intron          2172..>2181
FT                   /number=1
XX
SQ   Sequence 2181 BP; 476 A; 552 C; 699 G; 454 T; 0 other;
     ccatggaaca ctgtgccctt tccttcccaa accctcaccc ctgggcctga ccctggagtc        60
     aagaactgca cttggcagag ttcagagaga agtcgcctgc tctcaagcct gggtcggcct       120
     ggagaagggg agaagcccca tgttgcatag agattaagct tgaattcgtt cccaggatgg       180
     gacctaagcc tgggaggatc cccaccttca ggaggtgatg gtgccattca ctgggatagg       240
     gaaactggca ggaggagccg gttgttgagg gttgggggtg cagacagtct gttggtccca       300
     ttggtcttga ggtgtgtggg ggacaactag agagaactat tgtcccctgc ttccacgagg       360
     tgacatctcc ctcctgcctt cagctctatt ttagggatca aggagtcctt ggagctgctc       420
     ctaggcattc tcataagggc cagaagagct ctgcatgtct gtccagcggc tctgcagagt       480
     taaggctgtg ggtcatacca gccacaccct cagcgtggtc catgtcacag aaacatgtgg       540
     aaaccaggtg atttcccagc ctcctggtca ggaggtgggg ttttccatcc ccagggagtc       600
     acttcccagt ttctcactca gcactcagca cctagaagca ccatccttgc aggctccact       660
     gtggggctgg tggccgggag aaagggtctc tgtacctctt caggcagcct gcagtgagga       720
     aacagggaac agaatagcct cctgccaccc agcccacccc aacccttaga aatgccctat       780
     gtgctggggg ctaggacccc cgtaatccag ggctggagga atgtgctctg gccccgcagg       840
     gctggccctg tattagggct ggcactcaaa gtggggatgg ggggacagat tgcagctgga       900
     atgggtgctc ggtcatgatg taaatcctgg ggaagccagc tctcctgggc ctggtctcag       960
     cagcccctca ggggcctgca gcttccctgg tgacattctc tcccagcctc tgttcatctg      1020
     ccccctgcct gggcaggaga cttgagcagg gaagtgcaga gtcttctccc tgtgagaagg      1080
     ctggatgcgt gtttaaggat aaatgaacac gcgaagagta gtaacaacag ccaagattta      1140
     taaatgccta ttgttatata tgtagatact tacttaagta tatataaagt acagactgca      1200
     ttatgtatat tacatatctt taaattttta gaatagtcct atgaggtcag ttcagagatc      1260
     cagacccagg tggtctggct ctagagtcta aacaggccga gtgcagtggc tcacacctat      1320
     aatcccagca ccttgggagg ccagaggcgg gaagatcact tgagggtggg aagaacacgt      1380
     gagctcagga gttcgagacc agcctggaca acatggcgaa accccatctc tataaagaaa      1440
     tcagcctagc atggtggccc gagcctgtag tcccagctac tcgggaggct gaggtgggag      1500
     gatcgcttga gcgcaggagt tggaggctgc agtgagctat gggtgaaaga gtgagacctt      1560
     gtctcaaaaa aaattaaaaa ataagaatta aatatattta aaatagagtc taaataagtg      1620
     aatgatctag aattctcttg gttcccctaa agcagctgtc agctttgggg gatgtttttc      1680
     caaattagtg cctcaccctc acgggacagg gaagcctgtg ggagctggga gggcaggtgg      1740
     aggccgggca ggtggaggcc gggcaggtgg agatggtgat tcgaagagga ggggacgata      1800
     ggaggaggtt gaggggtcac ccgagtgctg ggagtgacgc tggaggtatc ggcccagcga      1860
     tgctggagtg gtcgggtcgg aggcccagca gcgtctgggg aggggcgtgg gggaggcgtg      1920
     tccaaggccg gctggccccg ccccgccccg ccgcctggcc tctggcccgc tggggcgcgg      1980
     gctttcgctt tcagtcgagg gctagcgagc gcagcggagc ctggagagaa ggcgctgggc      2040
     tgcgagggcg cgagggcgcg agggcagggg gcaaccggac cccgcccgca cccatggcgc      2100
     ccgtcgccgt ctgggccgcg ctggccgtcg gactggagct ctgggctgcg gcgcacgcct      2160
     tgcccgccca ggtgggtgac t                                                2181
//