spacer

EBI Dbfetch

ID   X78682; SV 1; linear; mRNA; STD; MUS; 1000 BP.
XX
AC   X78682;
XX
DT   19-SEP-1994 (Rel. 41, Created)
DT   19-SEP-1994 (Rel. 41, Last updated, Version 2)
XX
DE   M.musculus mRNA for B-cell receptor associated protein (BAP) 32
XX
KW   B-cell receptor associated protein; prohibitin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 8070406.
RA   Terashima M., Kim K.M., Adachi T., Nielsen P.J., Reth M., Koehler G.,
RA   Lamers M.C.;
RT   "The IgM antigen receptor of B lymphocytes is associated with prohibitin
RT   and a prohibitin-related protein";
RL   EMBO J. 13(16):3782-3792(1994).
XX
RN   [2]
RP   1-1000
RA   Adachi T., Nielsen P.J.;
RT   ;
RL   Submitted (07-APR-1994) to the INSDC.
RL   T. Adachi, P.J. Nielsen, Max Planck Institut for Immunology, Stuebeweg 51,
RL   79108 Freiburg i. Br., FRG
XX
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
DR   EuropePMC; PMC395291; 8070406.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1000
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_line="J558L"
FT                   /cell_type="plasmacytoma"
FT                   /tissue_type="lymploid"
FT                   /db_xref="taxon:10090"
FT   CDS             42..860
FT                   /product="prohibitin or B-cell receptor associated protein
FT                   (BAP) 32"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="CAA55349.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   polyA_signal    963..968
XX
SQ   Sequence 1000 BP; 245 A; 262 C; 284 G; 209 T; 0 other;
     cagagtgaaa gcaggtgtga gtggaagcaa cagaaggagt catggctgcc aaagtgtttg        60
     agtccattgg aaagttcggc ctggcgttgg cagttgcagg aggcgtggtg aactctgctt       120
     tgtataatgt ggatgctgga cacagagctg tcatctttga ccgattccgt ggcgtacagg       180
     acattgtggt cggggaaggg actcatttcc tcatcccttg ggtacagaaa ccaattatct       240
     ttgactgccg ctctcgacca cggaacgtac cagtcatcac tggtagcaaa gacttgcaga       300
     acgtcaatat cacactgcga atcctcttcc ggccggtggc cagccagctt cctcgtatct       360
     acaccagcat tggcgaggac tatgatgagc gggtcctgcc ttctatcacc acagagatcc       420
     tcaagtcggt ggtggctcga ttcgatgctg gagaattgat tacccagcga gagctggtct       480
     ccaggcaggt gagcgatgac ctcacagagc gagcggcaac atttgggctt atcctggatg       540
     acgtgtccct gacacatctg accttcggga aggagttcac agaggcagta gaagccaaac       600
     aggtggctca gcaggaagcg gagagagcca gatttgtggt ggaaaaggct gagcagcaga       660
     agaaggcagc catcatctct gctgagggtg actccaaggc cgctgagctg atcgccaact       720
     cgctggccac ggcaggcgac ggcctgatcg agctgcggaa gctggaggcc gccgaggaca       780
     ttgcgtacca gctctcccgc tctcggaaca tcacctacct gccagcgggc cagtccgtgc       840
     ttctccagct tccccagtga ggccagccgg gccacggcct ccatcatgct gaatgacgcc       900
     ttccttctgc cccaccccag aaaagtcact gtgaaatttc atgattggct taaagtgaag       960
     gaaataaagg taaaatcact tcagatctct aaaaaaaaaa                            1000
//


spacer
spacer