spacer

EBI Dbfetch

ID   X76850; SV 1; linear; mRNA; STD; MUS; 1247 BP.
XX
AC   X76850;
XX
DT   14-JAN-1994 (Rel. 38, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   M. musculus mRNA for MAP kinase-activated protein kinase 2
XX
KW   MAP kinase activated protein kinase-2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1241
RX   DOI; 10.1016/0014-5793(93)81628-D.
RX   PUBMED; 8262198.
RA   Engel K., Plath K., Gaestel M.;
RT   "The MAP kinase-activated protein kinase 2 contains a proline-rich
RT   SH3-binding domain";
RL   FEBS Lett. 336(1):143-147(1993).
XX
RN   [2]
RC   Revised by [3]
RA   Gaestel M.;
RT   ;
RL   Submitted (12-JAN-1994) to the INSDC.
RL   M. Gaestel, Max-Delbrueck-Zentrum fr. Molekulare Medizin, AG
RL   Stressproteine, R. Rssle Str. 10, 13122 Berlin, FRG
XX
RN   [3]
RP   1-1247
RA   Gaestel M.;
RT   ;
RL   Submitted (28-NOV-1995) to the INSDC.
RL   M. Gaestel, Max-Delbrueck-Zentrum fr. Molekulare Medizin, AG
RL   Stressproteine, R. Rssle Str. 10, 13122 Berlin, FRG
XX
DR   MD5; 0fe0d22a3e5383fe0d2a986bd7ef7075.
DR   Ensembl-Gn; ENSMUSG00000016528; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016672; mus_musculus.
DR   EuropePMC; PMC538991; 15618193.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1247
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="mouse lung lambda gt10 Clontech ML 1046a"
FT                   /tissue_type="lung"
FT                   /germline
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1158
FT                   /product="MAP kinase-activated protein kinase 2"
FT                   /db_xref="GOA:P49138"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027442"
FT                   /db_xref="MGI:MGI:109298"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49138"
FT                   /protein_id="CAA54183.1"
FT                   /translation="IRGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAIT
FT                   DDYKVTSQVLGLGINGKVLRIFDKRTQQKFALKMLQDCPKARREVELTWRASQCPHIVH
FT                   IVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLH
FT                   SINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGP
FT                   EKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSE
FT                   EVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEE
FT                   MTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARAVEDAALAH"
FT   polyA_signal    1206..1211
XX
SQ   Sequence 1247 BP; 334 A; 345 C; 316 G; 252 T; 0 other;
     attcggggct ctccgggcca gactccgccg gcgcctttcc ccagccctcc accgccagcc        60
     ccggcccagc cgccgccgcc gttcccccag ttccacgtca agtcgggcct gcagatccga       120
     aagaacgcca tcaccgacga ctacaaggtc accagccaag tgcttggcct gggcatcaac       180
     gggaaggtgc tgcggatctt cgacaagaga acccagcaaa aattcgccct aaagatgctc       240
     caggactgtc cgaaggcgcg cagagaggtg gagctgactt ggagggcctc ccagtgccca       300
     cacattgtgc acatcgtgga tgtctatgag aacctgtatg ccgggaggaa gtgcctgctg       360
     attgtcatgg agtgtctcga tggtggagag ctctttagtc gaatccagga ccgaggagac       420
     caggcattca cagaaagaga ggcgtcagag atcatgaaga gcatcggcga ggccatccag       480
     tacctgcact cgatcaacat tgctcaccgg gatgtcaagc ctgagaacct cttatatact       540
     tccaaaaggc ccaatgccat tttgaaactc actgattttg gctttgccaa ggaaaccacc       600
     agtcacaact ctttgaccac tccgtgttat acaccatact atgtggctcc ggaagtcctg       660
     ggcccggaga agtatgacaa gtcctgtgac atgtggtcct tgggtgtcat catgtatatt       720
     ttgctgtgtg ggtatccccc cttctattcc aatcacggcc ttgccatctc tccgggcatg       780
     aagactcgta ttcgaatggg ccagtatgaa tttcctaacc cggagtggtc agaagtatca       840
     gaagaagtga agatgcttat ccggaatctg ctaaaaacag agcccaccca gagaatgacc       900
     atcacagaat tcatgaacca cccctggatc atgcaatcta cgaaggtccc tcagactcca       960
     ctgcacacca gccgtgtcct gaaggaggac aaggaacgat gggaggatgt caaggaggag      1020
     atgaccagtg ccttggccac gatgcgtgtt gactatgagc agatcaagat aaagaagata      1080
     gaagacgcat ccaaccctct gcttctcaag aggcggaaga aagctcgtgc tgtggaggat      1140
     gcggctctcg cccactgagc cgctctgtct cccacccact ggaggacaag caataactct      1200
     acatgaatat attttttaga caaagagaca caaaaaaaaa aaaaaaa                    1247
//


spacer
spacer