Dbfetch

ID   X76341; SV 2; linear; mRNA; STD; MUS; 1646 BP.
XX
AC   X76341;
XX
DT   02-DEC-1993 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for glutathione reductase
XX
KW   glutathione reductase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RC   revised by [4]
RA   Werner D.;
RT   ;
RL   Submitted (25-NOV-1993) to the INSDC.
RL   D. Werner, German Cancer Research Center, Division Cellular Biochemistry
RL   (0225), Im Neuenheimer Feld 280, 69120 Heidelberg, FRG
XX
RN   [4]
RP   1-1646
RA   Werner D.;
RT   ;
RL   Submitted (20-APR-1999) to the INSDC.
RL   D. Werner, German Cancer Research Center, Division Cellular Biochemistry
RL   (0225), Im Neuenheimer Feld 280, 69120 Heidelberg, FRG
XX
RN   [6]
RX   DOI; 10.1111/j.1432-1033.1990.tb15431.x.
RX   PUBMED; 2185014.
RA   Tutic M., Lu X., Schirmer R.H., Werner D.;
RT   "Cloning and sequencing of mammalian glutathione reductase cDNA";
RL   Eur. J. Biochem. 188(3):523-528(1990).
XX
DR   MD5; 88d5506bce55a6bf48d5befdaa3824ba.
DR   Ensembl-Gn; ENSMUSG00000031584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033992; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="cDNA library prepared from RNA of Ehrlich
FT                   ascites tumour cells in the lambda gt10 vector"
FT                   /clone="lambda GRM34"
FT                   /cell_line="Ehrlich ascites tumour cell"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1503
FT                   /product="glutathione reductase"
FT                   /db_xref="GOA:P47791"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:95804"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47791"
FT                   /protein_id="CAA53959.3"
FT                   /translation="MALLPRALGVGAAPSLRRAARALTCTMASPGEPQPPAPDTSSFDY
FT                   LVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDH
FT                   VDYGFQSCEGKFSWHVIKQKRDAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVE
FT                   VNGKKFTAPHILIATGGVPTVPHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAV
FT                   EIAGILSALGSKTSLMIRHDKVLRNFDSLISSKCTEELENAGVEVLKFTQVKEVKKTSS
FT                   GLELQVVTSVPGRKPTTTVIPDVDCLLWAIGRDPNSKGLNLNKVGIQTDEKGHILVDEF
FT                   QNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPI
FT                   GTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQ
FT                   GIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR"
XX
SQ   Sequence 1646 BP; 394 A; 434 C; 479 G; 339 T; 0 other;
     atggcgctgc tgccccgggc gctgggcgtg ggcgcggccc cgagcctgcg gcgggcggcg        60
     cgcgcgctca cctgcaccat ggcgagtccc ggcgagccgc agcccccggc cccggacacc       120
     tcttccttcg actacctggt gatcggcggc ggctccggcg ggctggccag cgcgcggcgg       180
     gcggcggagc tcggcgccag ggccgcggtg gtggagagtc acaagctggg tggcacttgc       240
     gtgaatgttg gatgtgtacc caagaaggta atgtggaaca cagcagtgca ctcggaattc       300
     atgcacgatc acgtggatta cggctttcaa agctgtgagg gtaaattcag ttggcatgtc       360
     atcaagcaga agagggatgc ctatgtgagc cgcctgaaca ccatctatca aaataattta       420
     accaagtccc acatagaaat tatccacggc tatgcaacat tcgcagatgg tcctcggccc       480
     acggtggaag tcaatgggaa aaagtttacc gctccacaca tcctgattgc cacaggaggc       540
     gtgcccacag ttcctcacga gagccagatc ccaggcgcca gcttggggat caccagcgat       600
     ggcttctttc agctggagga cttgcccagc cgcagtgtca tcgtgggggc cgggtacatt       660
     gctgtggaga tcgcaggcat cctctcggcc ctgggctcca agacatctct tatgatcagg       720
     catgataagg tactgagaaa ttttgattca ctcatcagtt ccaagtgcac cgaggaactg       780
     gagaatgccg gcgtggaggt gttgaagttc acacaggtta aggaagtaaa aaagacatca       840
     tcaggcctgg agctccaagt ggtgacttct gtacctggta ggaagcccac cacaactgtg       900
     attccagatg ttgactgcct gctctgggcc attggacggg acccaaattc taagggcctg       960
     aatctgaata aagtgggcat tcagacggat gaaaagggcc acatcctagt agacgaattc      1020
     cagaatacca acgtcaaagg cgtttatgct gtgggagacg tctgtgggaa agcgcttctc      1080
     accccagttg caatcgctgc tggccggaaa cttgcccata gactgtttga atgcaaacaa      1140
     gattccaaat tagactatga caacatccct actgtggtct tcagccaccc ccctattggg      1200
     accgtggggc tcactgaaga cgaagctgtt cataagtatg ggaaagacaa tgtgaaaatc      1260
     tactcgactg cctttacccc gatgtatcac gctgtgacca cgaggaagac gaaatgcgtc      1320
     atgaagatgg tttgtgccaa caaagaggaa aaggtggttg gcattcacat gcaggggatt      1380
     ggctgtgatg agatgctgca gggcttcgct gtagcggtga aaatgggggc caccaaggcc      1440
     gacttcgaca acacagtggc cattcatcct acctcttcag aggagctggt caccctgcgc      1500
     tgagagcctg gggacccagg tggctagcgg tgcgaccagc aggcctccgg gaggaaccga      1560
     tcgagtttac cgcccagctt ctacagatct ctgtatttta atcaggaact tctggtggtg      1620
     taaatttcca gctaaacaca cacacg                                           1646
//