Dbfetch

ID   X72795; SV 1; linear; mRNA; STD; MUS; 2019 BP.
XX
AC   X72795;
XX
DT   30-NOV-1993 (Rel. 37, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   M.musculus mRNA for gelatinase B
XX
KW   gelatinase B.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1111/j.1432-1033.1993.tb18359.x.
RX   PUBMED; 8243459.
RA   Masure S., Nys G., Fiten P., Van Damme J., Opdenakker G.;
RT   "Mouse gelatinase B. cDNA cloning, regulation of expression and
RT   glycosylation in WEHI-3 macrophages and gene organisation";
RL   Eur. J. Biochem. 218(1):129-141(1993).
XX
RN   [2]
RP   1-2019
RA   Masure S.;
RT   ;
RL   Submitted (03-MAY-1993) to the INSDC.
RL   S. Masure, Rega Inst. for Medical Research, Minderbroedersstraat 10, B-3000
RL   Leuven, BELGIUM
XX
DR   MD5; e7f12e56a1a1c206430b38d3da5fee85.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026883; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026850; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026821; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026859; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026601; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027306; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026059; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026578; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026716; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026682; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026818; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026701; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027363; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025796; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026132; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059233; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059259; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059205; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059192; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058891; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059664; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059162; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0058862; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0058966; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0058947; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059077; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058925; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059849; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058730; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058170; mus_musculus_wsbeij.
DR   EuropePMC; PMC148819; 12595423.
DR   EuropePMC; PMC523004; 15501793.
DR   EuropePMC; PMC538991; 15618193.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2019
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="pSM2"
FT                   /cell_type="macrophage"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1798
FT                   /codon_start=2
FT                   /gene="MMP-9"
FT                   /product="gelatinase b"
FT                   /EC_number="3.4.24.35"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="CAA51315.1"
FT                   /translation="PRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGD
FT                   GYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTF
FT                   EGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFE
FT                   GRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFL
FT                   GKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSS
FT                   VPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPT
FT                   IPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTAGSSEASTESLSPAD
FT                   NPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFE
FT                   DPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPGKALLFSKGR
FT                   VWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNK
FT                   VDPEVNQVDDVGYVTYDLLQCP"
XX
SQ   Sequence 2019 BP; 412 A; 627 C; 550 G; 430 T; 0 other;
     gccgcgagac atgatcgatg acgccttcgc gcgcgccttc gcggtgtggg gcgaggtggc        60
     acccctcacc ttcacccgcg tgtacggacc cgaagcggac attgtcatcc agtttggtgt       120
     cgcggagcac ggagacgggt atcccttcga cggcaaggac ggccttctgg cacacgcctt       180
     tccccctggc gccggcgttc agggagatgc ccatttcgac gacgacgagt tgtggtcgct       240
     gggcaaaggc gtcgtgatcc ccacttacta tggaaactca aatggtgccc catgtcactt       300
     tcccttcacc ttcgagggac gctcctattc ggcctgcacc acagacggcc gcaacgacgg       360
     cacgccttgg tgtagcacaa cagctgacta cgataaggac ggcaaatttg gtttctgccc       420
     tagtgagaga ctctacacag agcacggcaa cggagaaggc aaaccctgtg tgttcccgtt       480
     catctttgag ggccgctcct actctgcctg caccactaaa ggccgctcgg atggttaccg       540
     ctggtgcgcc accacagcca actatgacca ggataaactg tatggcttct gccctacccg       600
     agtggacgcg accgtagttg ggggcaactc ggcaggagag ctgtgcgtct tccccttcgt       660
     cttcctgggc aagcagtact cttcctgtac cagcgacggc cgcagggatg ggcgcctctg       720
     gtgtgcgacc acatcgaact tcgacactga caagaagtgg ggtttctgtc cagaccaagg       780
     gtacagcctg ttcctggtgg cagcgcacga gttcggccat gcactgggct tagatcattc       840
     cagcgtgccg gaagcgctca tgtacccgct gtatagctac ctcgagggct tccctctgaa       900
     taaagacgac atagacggca tccagtatct gtatggtcgt ggctctaagc ctgacccaag       960
     gcctccagcc accaccacaa ctgaaccaca gccgacagca cctcccacta tgtgtcccac      1020
     tatacctccc acggcctatc ccacagtggg ccccacggtt ggccctacag gcgccccctc      1080
     acctggcccc acaagcagcc cgtcacctgg ccctacaggc gccccctcac ctggccctac      1140
     agcggcccct actgcgggct cttctgaggc ctctacagag tctttgagtc cggcagacaa      1200
     tccttgcaat gtggatgttt ttgatgctat tgctgagatc cagggcgctc tgcatttctt      1260
     caaggacggt tggtactgga agttcctgaa tcatagagga agcccattac agggcccctt      1320
     ccttactgcc cgcacgtggc cagccctgcc tgcaacgctg gactccgcct ttgaggatcc      1380
     gcagaccaag agggttttct tcttctctgg acgtcaaatg tgggtgtaca caggcaagac      1440
     cgtgctgggc cccaggagtc tggataagtt gggtctaggc ccagaggtaa cccacgtcag      1500
     cgggcttctc ccgcgtcgtc ccgggaaggc tctgctgttc agcaaggggc gtgtctggag      1560
     attcgatttg aagtctcaga aggtggatcc ccagagcgtc attcgcgtgg ataaggagtt      1620
     ctctggtgtg ccctggaact cacacgacat cttccagtac caagacaaag cctatttctg      1680
     ccatggcaaa ttcttctggc gtgtgagttt ccaaaatgag gtgaacaagg tggaccctga      1740
     ggtgaaccag gtggacgacg tgggctacgt gacctacgac ctcctgcagt gcccttgaac      1800
     tagggctcct tctttgcttc aaccgtgcag tgcaagtctc tagagaccac caccaccacc      1860
     accacacaca aaccccatcc gagggaaagg tgctagctgg ccaggtacag actggtgatc      1920
     tcttctagag actgggaagg agtggaggca ggcagggctc tctctgccca ccgtcctttc      1980
     ttgttggact gtttctaata aacacggatc cccaacctt                             2019
//