spacer

EBI Dbfetch

ID   X72794; SV 1; linear; genomic DNA; STD; MUS; 8190 BP.
XX
AC   X72794;
XX
DT   30-NOV-1993 (Rel. 37, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   M.musculus gene for gelatinase B
XX
KW   gelatinase B.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1111/j.1432-1033.1993.tb18359.x.
RX   PUBMED; 8243459.
RA   Masure S., Nys G., Fiten P., Van Damme J., Opdenakker G.;
RT   "Mouse gelatinase B. cDNA cloning, regulation of expression and
RT   glycosylation in WEHI-3 macrophages and gene organisation";
RL   Eur. J. Biochem. 218(1):129-141(1993).
XX
RN   [2]
RP   1-8190
RA   Masure S.;
RT   ;
RL   Submitted (03-MAY-1993) to the INSDC.
RL   S. Masure, Rega Inst. for Medical Research, Minderbroedersstraat 10, B-3000
RL   Leuven, BELGIUM
XX
DR   MD5; 0865f6a7de9865a9c29a52601f8c1d95.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
DR   EuropePMC; PMC409857; 10587514.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8190
FT                   /organism="Mus musculus"
FT                   /strain="C57 Black/6"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="1 year"
FT                   /clone="MMG1"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   misc_feature    573..578
FT                   /note="SP1 box"
FT   misc_feature    639..648
FT                   /note="NF-kappa-B element"
FT   misc_feature    695..701
FT                   /note="AP-1 box"
FT   misc_feature    716..721
FT                   /note="SP1 box"
FT   repeat_region   1040..1089
FT                   /note="CA repeat region"
FT   misc_feature    1093..1099
FT                   /note="AP-1 box"
FT   misc_feature    1119..1124
FT                   /note="SP1 box"
FT   regulatory      1152..1156
FT                   /regulatory_class="TATA_box"
FT   CDS             join(1200..1340,1778..2007,2226..2374,2652..2780,
FT                   2890..3063,3244..3417,3768..3944,4050..4205,5361..5694,
FT                   5796..5935,6205..6355,6460..6563,7714..7847)
FT                   /gene="MMP-9"
FT                   /product="gelatinase b"
FT                   /EC_number="3.4.24.35"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="CAA51314.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP"
FT   mRNA            join(<1200..1340,1778..2007,2226..2374,2652..2780,
FT                   2890..3063,3244..3417,3768..3944,4050..4205,5361..5694,
FT                   5796..5935,6205..6355,6460..6563,7714..>7847)
FT                   /gene="MMP-9"
FT   exon            <1200..1340
FT                   /number=1
FT   intron          1341..1777
FT                   /number=1
FT   exon            1778..2007
FT                   /number=2
FT   intron          2008..2225
FT                   /number=2
FT   exon            2226..2374
FT                   /number=3
FT   intron          2375..2651
FT                   /number=3
FT   exon            2652..2780
FT                   /number=4
FT   intron          2781..2889
FT                   /number=4
FT   exon            2890..3063
FT                   /number=5
FT   intron          3064..3243
FT                   /number=5
FT   exon            3244..3417
FT                   /number=6
FT   intron          3418..3767
FT                   /number=6
FT   exon            3768..3944
FT                   /number=7
FT   intron          3945..4049
FT                   /number=7
FT   exon            4050..4205
FT                   /number=8
FT   intron          4206..5360
FT                   /number=8
FT   exon            5361..5694
FT                   /number=9
FT   intron          5695..5795
FT                   /number=9
FT   exon            5796..5935
FT                   /number=10
FT   intron          5936..6204
FT                   /number=10
FT   exon            6205..6355
FT                   /number=11
FT   intron          6356..6459
FT                   /number=11
FT   exon            6460..6563
FT                   /number=12
FT   intron          6564..7713
FT                   /number=12
FT   exon            7714..>7847
FT                   /number=13
FT   regulatory      8046..8051
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 8190 BP; 1773 A; 2250 C; 2244 G; 1923 T; 0 other;
     gagctcacca gtgagaagca tctaagagaa gcttgggaga acacccagct ctctctctcc        60
     ggctcacagg tctgttcgtt gggaagcaca tgaaggtctg ggcacacagg aggcttagtc       120
     agaacagctt gctgaagaca gatcaaggcc ctgctccacc atggtggcag gcgaggagga       180
     tggaaggccg ggggctgccg gctgttggca agactgtgcc aaagctttcc tgagtggagc       240
     agggcagggc tggaggaggg gaagggtcca tgacgatctc acagctcggg agaggaaggt       300
     gtttgcccca tccaggtcac cccaaggctt agagccaaga ccccagtctc ctaatttcca       360
     atcacaaacc tgacaccatc aactgaggtc tcgtgaacac tgctgaaagt ggtttttctg       420
     tgtttcgaga gtctcatttt atcctcagat caatataggg acaaaggctt gagcgacaaa       480
     gggtctgttt ttgttcttta aacagaagag gaaggatagt gctagcctga gaaggatgaa       540
     gcttctgctt gctcccacat gtgtgtgtcc ccccgccccc caggctcatc tttccttccc       600
     caaggagtca gcctgctgga gctaggggtt tgccccatgg aattccccaa atcctgcctc       660
     aaagagcctg ctcccagagg ccaggagagg aagctgagtc aaagactcta tcagggggcg       720
     gggatgagag gatagaacct acagtgtggg gatgggctcc aggctgcact ctggccaggg       780
     agggggtgtc tcagaagccc aaggaagagg ggtctcgggc ctcaggtctc ccagtctttt       840
     actgggctga tcagtcaggg ccgtcagacc tagggctagg tgaatgcccc atcctgcaca       900
     ccctccttcc ctttcccaca aagtctgcag tttgcagaaa ctaaaccctg agttctgtgg       960
     tttcctgtgg gtctgggggt cctgcctgac ttggcaatgg gggactgtgg gcagggcata      1020
     agggaggggg tagtgtaaac acacacacac acacacacac acacacacac acacacacac      1080
     acacacacac gctgagtcag cataagcctg gaggggaggg gcggggtcac tgattccgtt      1140
     ttactgcctc tttaaaatct ctgcaaaggc agcgttagcc agaagctgcg gtcctcacca      1200
     tgagtccctg gcagcccctg ctcctggctc tcctggcttt cggctgcagc tctgctgccc      1260
     cttaccagcg ccagccgact tttgtggtct tccccaaaga cctgaaaacc tccaacctca      1320
     cggacaccca gctggcagag gtagacagat ggctcggtgg atagctgaga agggctggtc      1380
     aggaagatgt ccccctctcc caaggaatgg ggcctcagat atgctttctg gatttggggg      1440
     tgatgggcat gtctgccagg gttaggcagt agggggtagg tggtctggag gctctgggca      1500
     gattcgggtc tgttggaggg acagattggg ttcggcttcg aagggttgtg acatggcgca      1560
     ggttggcagt gaacagttaa actctagtgg ggctgagggg taggcatggt ttatatcatc      1620
     tgaggtcgag gtgtgatgct gtcctcagga taggggaatt ctagctgtgt aggaagaact      1680
     ggtgtcctgg ccgtagagtc cctaagcatg tggcccagag gtccagagcc aaggtgccag      1740
     aactctgtga tgtctctgcc ccttcctcca tccacaggca tacttgtacc gctatggtta      1800
     cacccgggcc gcccagatga tgggagagaa gcagtctcta cggccggctt tgctgatgct      1860
     tcagaagcag ctctccctgc cccagactgg tgagctggac agccagacac taaaggccat      1920
     tcgaacacca cgctgtggtg tcccagacgt gggtcgattc caaaccttca aaggcctcaa      1980
     gtgggaccat cataacatca catactggtg agatgtcggg ctagaagcag gtgcctgggt      2040
     gggactggag gccagtttgc acctccggtt agctgaacac aagggatcct tagcaataca      2100
     agttccgaga gaggctgcag ccctgtgtgt tttgaagcga tcgtggtgta gctgctgccc      2160
     cgcccacccc catttgtaat ccgtgcatgc ccgatccccc atcgacgctg gcttttcacc      2220
     tccaggatcc aaaactactc tgaagacttg ccgcgagaca tgatcgatga cgccttcgcg      2280
     cgcgccttcg cggtgtgggg cgaggtggca cccctcacct tcacccgcgt gtacggaccc      2340
     gaagcggaca ttgtcatcca gtttggtgtc gcgggtgaga attcccgggc tgggcaggct      2400
     atgggaggga cgaccacgga cagagtagaa gggacagcag atctgtccgc tcttatgcct      2460
     gccccacaat ccctagtcgc tgcttccaca aatgacctcc cccaaccccc agcggctttg      2520
     gagtcgcagt cacctcttct caaagtctgg tgcgctgctc agcgggagac acagtcgctt      2580
     tcagtctctt gcccttaaag agagcaaagt gttgctgatt gagtcccttc ctctccgatg      2640
     gcctcttgca gagcacggag acgggtatcc cttcgacggc aaggacggcc ttctggcaca      2700
     cgcctttccc cctggcgccg gcgttcaggg agatgcccat ttcgacgacg acgagttgtg      2760
     gtcgctgggc aaaggcgtcg gtgagatcct gagccttcca gtatccgccc catccccacc      2820
     cctgtcccaa ctcccttctc ttacactggt gtgtggccag acgccctgac tctagcctcc      2880
     tttctacagt gatccccact tactatggaa actcaaatgg tgccccatgt cactttccct      2940
     tcaccttcga gggacgctcc tattcggcct gcaccacaga cggccgcaac gacggcacgc      3000
     cttggtgtag cacaacagct gactacgata aggacggcaa atttggtttc tgccctagtg      3060
     agagtgagta tgcgctgggg gtggggagcg gggcgccgcc ttgaaggttc cagaatcttc      3120
     tttcccagtc tctctttgcc atcagtggtg tggctactcg ccctctccct gggtctggtc      3180
     ccctctgtga aatgagacgc atgctggggc cgggcttggc ggtaataccg tgggtctcct      3240
     caggactcta cacggagcac ggcaacggag aaggcaaacc ctgtgtgttc ccgttcatct      3300
     ttgagggccg ctcctactct gcctgcacca ctaaaggccg ctcggatggt taccgctggt      3360
     gcgccaccac agccaactat gaccaggata aactgtatgg cttctgccct acccgaggta      3420
     cctctgcccc gcctatcagg gtcagcccgg ctctgctttc cagcattggt ctctaaaggt      3480
     ggcttttcca tccattcatt tccttcctct atttaccatc cgccgtctgc ctccacacct      3540
     cctctccttg actcccaatt gggcagcctt ttttgtttac ccttaggctt tggtctccaa      3600
     tcttagcctc tgcctatcaa tattttccgg cttccgcggt gctccacagc gccccctagg      3660
     cttcaaaaac taggccatgg aggatctcta gctcagctta gtttggtcca tccctggcac      3720
     catattagat ccacccatct ggctcacttg attcttggtc tctccagtgg acgcgaccgt      3780
     agttgggggc aactcggcag gagagctgtg cgtcttcccc ttcgtcttcc tgggcaagca      3840
     gtactcttcc tgtaccagcg acggccgcag ggatgggcgc ctctggtgtg cgaccacatc      3900
     gaacttcgac actgacaaga agtggggttt ctgtccagac caaggtgagc ggggcactga      3960
     ggctcctggg gtggggcctg agtcacctcc tggcagtcaa ggcggagcag ccagggctgg      4020
     tggcatttca gactccttct accttccagg gtacagcctg ttcctggtgg cagcgcacga      4080
     gttcggccat gcactgggct tagatcattc cagcgtgccg gaagcgctca tgtacccgct      4140
     gtatagctac ctcgagggct tccctctgaa taaagacgac atagacggca tccagtatct      4200
     gtatggtgag gctgggggac agagacgagg agcagagaga aggatgtggc tcagctgtag      4260
     gaagaggaga ggggagaaac ggaacctcaa tatctatctg ggtcagggcc tgagtgccca      4320
     gtaagtggag atggcactct aggcccgggt tcaaaagcca gcccagggct gggtgtgcag      4380
     cctagtggtt agattacata ctgaatgatg caaagcagac atgaggccct gcgtttgatc      4440
     ctcctcagca agaagggtca gccaagccac ttcataggtg aacttagtta ggtgtgtcac      4500
     ttccctccca tataaagtgg cggcgtgcga taatagcgtg gctctcataa ggctttgata      4560
     gggttaactg aagtagaatg atgcctgact ttattaagtg acatttgatt gtcttgtctt      4620
     gtttttgatc atcattaacc tttgaaaaat ggggatattt gctgggtggt ggcatagcaa      4680
     gcttgtgatc ccagaacccg gggggattgc gacaaaaaag ttaccatgag ttttaggcta      4740
     gcctgagcga tacactaagc tccaggccaa cctgggctac ttaaagctct gacccaaagg      4800
     aacttccaaa gattagttga tttatatttc tatgggtgtt ttgcctgaat gtatgtgcac      4860
     aaggtatgtg caatgccagc agaggccaga agagggcgtc agatcactta ggactggaga      4920
     agcagattgt tgttagctgc catgtgggta ttgggaaatg aacccaggtc ctctggaaga      4980
     gcagccagtg gtcttaatta actattgagc catgtcttca gcccccaaag gagcttttaa      5040
     aggcatagca ggccaggaat gtttgccctt aggagtcaga ggcagctcac agcactgttt      5100
     gacacagtgg tcacccaaaa gactctctcc ctgcctgact cgggaaggag ggacattctg      5160
     cctgttcggt cctgagaacc cagtccatat cttcacagag ctcagttctg gacacttagg      5220
     cttggcatat gagaagaggc ttgctgcgtg tagcctctag cttcaaggga agactgaagg      5280
     caccattgct gggcttggtg gtaggctggg gctacagaga aatgctgact agtgtgtctt      5340
     atctagtgtc ttgtttttag gtcgtggctc taagcctgac ccaaggcctc cagccaccac      5400
     cacaactgaa ccacagccga cagcacctcc cactatgtgt cccactatac ctcccacggc      5460
     ctatcccaca gtgggcccca cggttggccc tacaggcgcc ccctcacctg gccccacaag      5520
     cagcccgtca cctggcccta caggcgcccc ctcacctggc cctacagcgc cccctactgc      5580
     gggctcttct gaggcctcta cagagtcttt gagtccggca gacaatcctt gcaatgtgga      5640
     tgtttttgat gctattgctg agatccaggg cgctctgcat ttcttcaagg acgggtaagc      5700
     agggagggtg tgtgggtgag agagggggtt tggagaggat cctgcttgcg tcttccacca      5760
     actttctcgg gccctgatat ttcctttctt ctcagttggt actggaagtt cctgaatcat      5820
     agaggaagcc cattacaggg ccccttcctt actgcccgca cgtggccagc cctgcctgca      5880
     acgctggact ccgcctttga ggatccgcag accaagaggg ttttcttctt ctctggttag      5940
     tttgtgcccc tctagctcat cgatccctca gtatccgtca gcttaggaca gacacctagt      6000
     gtaacccgtg aaactgcgac tccaaaagag cgcccctgcc cagctgataa gatttgacat      6060
     tggggggacg gacggacgga cggacggtac tgaattgcaa ttccccttga gtagctctga      6120
     tacttagctt ctctggctcc tgcctcctgc ccttcaaaga gactgtgcca caccttagtg      6180
     tctactgacc cttctcttcc gcaggacgtc aaatgtgggt gtacacaggc aagaccgtgc      6240
     tgggccccag gagtctggat aagttgggtc taggcccaga ggtaacccac gtcagcgggc      6300
     ttctcccgcg tcgtctcggg aaggctctgc tgttcagcaa ggggcgtgtc tggaggtaag      6360
     agcgaccgag gccaccagta gggggagccc tagcgccact ctcccgcagc tctggggtgg      6420
     ggagcgggag aggctcatcg cttgtccacc ttcctgcaga ttcgacttga agtctcagaa      6480
     ggtggatccc cagagcgtca ttcgcgtgga taaggagttc tctggtgtgc cctggaactc      6540
     acacgacatc ttccagtacc aaggtgaggg ctgctgaggc tggccgggaa gggtcccttc      6600
     gtgaaatgtc tcccacactg gactccctct cttagcgact ggctagtttc tcagcaggag      6660
     agagcaagcc cttggagatt gaagggaatg ttctagataa gagccatata gagagcaccc      6720
     caagttcaca cagcccggac ctaaggtccg gattgcttgc atatcattct tttccgggaa      6780
     ctccagtaga gaacgcagct ctctagaagg ctcgttcctt gattattaaa cagtagccaa      6840
     gggcctataa tgtgcaggac tgccactagg gatacgtgga gaggcaagaa agtgtctttg      6900
     ggcaagtcac tacctctctt ggggcctcag tttccccatc tgtaaaatgt attatctgga      6960
     gctctgttag gctaattcaa aggctcaaac ctcccaaatg tattattttt cagccatctc      7020
     ctttataccc ttccctccaa ccataccggt aacccagtaa cctttaatat attcttcaag      7080
     agtggggagg gttaggagag gagggcagag gttctgactg tgaccccaaa cgatacgaag      7140
     gtagaagaaa ctcacacggc cttgcctgtg tgtccaagtt ctcgtctcct ccccgttctc      7200
     ttgacatcct ccgtgctcca ccgaggctgg ctgctctttg aacagatcaa ggtcctccat      7260
     cccttaaggt cttcgggccc gttgtcccct atttggaaga cttcccactt aaactgtcac      7320
     cgggctgcct ctcttcaggc aaaggagaag atttaattgg ggctggctta caggtcagag      7380
     gctcagtcca ttattttcat ggtgggaaac gaggtggcac acaggcaaac gtggtgttgg      7440
     agaggtagct gagagctcta cctcagcagc aggcagcaag aagagagaga cactgggctt      7500
     ggcgtgaaca tctgaaatct caaagcccac cctagtgaca caggtcctcc aataaggcca      7560
     caccccctcc cacctcataa gtgccactcc ctatgggcct atagggtcca ttttcattca      7620
     aaccaccaca ggtgcttgta aaaatcttgt tccttttgtc aatgatgagg gagcagagga      7680
     ctcagctttc ttgtgtgttc ttgtttcccg tagacaaagc ctatttctgc catggcaaat      7740
     tcttctggcg tgtgagtttc caaaatgagg tgaacaaggt ggaccatgag gtgaaccagg      7800
     tggacgacgt gggctacgtg acctacgacc tcctgcagtg cccttgaact agggctcctt      7860
     ctttgcttca accgtgcagt gcaagtctct agagaccacc accaccacca ccacacacaa      7920
     accccatccg agggaaaggt gctagctggc caggtacaga ctggtgatct cttctagaga      7980
     ctgggaagga gtggaggcag gcagggctct ctctgcccac cgtcctttct tgttggactg      8040
     tttctaataa acacggatcc ccaacctttt ccagctactt tagtcaatca gcttatctgt      8100
     agttgcagat gcatccgagc aagaagacaa ctttgtaggg tggattctga ccttttattt      8160
     ttgtgtggcg tctgagaatt gaatcagctg                                       8190
//


spacer
spacer