spacer

EBI Dbfetch

ID   X67056; SV 1; linear; mRNA; STD; MUS; 3227 BP.
XX
AC   X67056;
XX
DT   17-AUG-1992 (Rel. 33, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   M.musculus GLYT mRNA for glycine transporter
XX
KW   glycine transporter.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3227
RA   Nelson N.;
RT   ;
RL   Submitted (09-JUN-1992) to the INSDC.
RL   N. Nelson, Roche Inst. of Molecular Biology, Nutley, NJ 07110, USA
XX
RN   [2]
RP   1-3227
RX   DOI; 10.1016/0014-5793(92)80875-H.
RX   PUBMED; 1618338.
RA   Liu Q.R., Nelson H., Mandiyan S., Lopez-Corcuera B., Nelson N.;
RT   "Cloning and expression of a glycine transporter from mouse brain";
RL   FEBS Lett. 305(2):110-114(1992).
XX
DR   MD5; 0d3d93dc333d34b97fcb5235cea47072.
DR   Ensembl-Gn; ENSMUSG00000028542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030269; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063857; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3227
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             241..2142
FT                   /gene="GLYT"
FT                   /product="glycine transporter"
FT                   /db_xref="GOA:P28571"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR003028"
FT                   /db_xref="MGI:MGI:95760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28571"
FT                   /protein_id="CAA47440.1"
FT                   /translation="MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAV
FT                   GLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPM
FT                   FKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDAS
FT                   NLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLG
FT                   VSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDK
FT                   YLEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATRLYAGFV
FT                   IFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGT
FT                   QFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYA
FT                   ASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIF
FT                   TVIQYRPITYNHYQYPGWAVRIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATK
FT                   PSRDWGPALLEHRTGRYAPTTTPSPEDGFEVQPLHPDKAQIPIVGSNGSSRFQDSRI"
XX
SQ   Sequence 3227 BP; 626 A; 979 C; 844 G; 778 T; 0 other;
     gaattcggca cgagggagcg gcaggcaacg cggcggggcg ggaggactgg cggctgcaga        60
     gagcctcggg aggctgatgc aactttccct ttaagaaagc cacctgggcg caccgcgtgc       120
     ggacccagca cgcctgggcc ggggcagcag tatctcttga ggcctgttgt ctgaaaggca       180
     ctgaacgcaa gagtctgcaa gtgtggtcca gatctccaga tcccccaacc cactgccacc       240
     atggtaggaa aaggtgccaa agggatgttg aatggtgctg tgcccagcga ggccaccaag       300
     aaggaccaga acctcacacg gggcaactgg ggcaaccaga tcgagtttgt actgacgagc       360
     gtgggctatg ccgtgggcct gggcaatgtc tggcgtttcc catacctctg ctatcgcaac       420
     gggggaggag ccttcatgtt cccctacttc atcatgctga tcttctgcgg gattcctctc       480
     ttcttcatgg agctttcctt cggccagttt gcaagccagg gctgcctggg ggtctggcgg       540
     atcagcccca tgttcaaagg cgtgggctat ggtatgatgg tggtgtccac atacattggc       600
     atctactaca acgtggtcat ctgcatcgcc ttctactact tcttctcgtc catgacgcac       660
     gtgctgccct gggcgtactg caacaacccc tggaacacac ctgactgtgc cggtgtgctg       720
     gacgcttcca acctcaccaa tggctcccgg cccgctgccc tgtctggcaa cctgtctcac       780
     ctgttcaact acaccttgca aaggaccagc cccagcgagg agtactggag gctgtatgtg       840
     ctgaagctgt cagacgacat tggaaacttt ggggaagtgc ggcttcccct cctaggctgc       900
     ctcggcgtct cctgggtggt tgtcttcctc tgtctcatcc gaggagtcaa gtcttcaggg       960
     aaagtggtgt acttcacggc cacattcccc tatgtggtgc tgaccattct gtttgttcgt      1020
     ggagtgaccc tggaaggagc cttcacgggt atcatgtact acctgacccc acaatgggac      1080
     aagtacctgg aggccaaggt ctggggggat gcagcctctc agatcttcta ttccctgggc      1140
     tgtgcatggg gtggcctcat caccatggcg tcctacaaca aatttcacaa caactgctac      1200
     cgggacagcg tcattatcag tatcaccaac tgtgctacca ggctctacgc cggcttcgtc      1260
     atcttctcca tcctgggctt catggccaat cacctgggtg tggatgtgtc tcgggtggca      1320
     gaccatgggc ctgggctagc ttttgtcgct taccctgagg ctctcacgct gcttcccatc      1380
     tctccactct ggtccttatt gtttttcttc atgctcatct tgctggggct gggtactcag      1440
     ttctgcctcc tagagaccct ggtcactgcc attgtggatg aggtagggaa tgagtggatt      1500
     ctgcagaaga agacctacgt gaccttgggc gtcgctgtgg ctggcttctt gctgggcatc      1560
     ccccttacca gccaggcagg catctactgg ctgctgctga tggacaacta tgcagccagc      1620
     ttctccttgg ttgtcatctc ctgtatcatg tgtgtatcca tcatgtacat ctatgggcac      1680
     cgtaactact tccaggacat ccagatgatg ctaggatttc ccccgcctct cttcttccag      1740
     atctgttggc gctttgtttc tccggctatc atctttttca ttctcatctt cacggtgatc      1800
     cagtaccggc caatcaccta caaccactac cagtacccag gctgggctgt gcgcatcggc      1860
     ttcctcatgg ctttgtcgtc tgtcatctgc atcccactgt acgcgctgtt ccagctctgc      1920
     cgcacagatg gggacacact tcttcagcgt ttgaaaaatg ccacaaagcc aagcagagac      1980
     tggggccccg ctctcctgga gcaccggact gggcgctacg ctcccactac aaccccctct      2040
     cccgaagacg ggtttgaggt ccagccactg cacccggaca aggcccagat tcccatcgtg      2100
     ggcagtaacg gctccagccg cttccaggac tcccggatat gagcgcaatt gttgcaaggg      2160
     gagaaacccc acccaaccct tgctcccacc acggagactg ggaggcggac aggtggaggc      2220
     ctgccccatc acaccctgtc tgggatggct gctgtcacct tgaccaccac tgctcatgtc      2280
     cccagtgttt acacatcctt tggatgccaa gacagcagct gggggtggga aagcgatggg      2340
     ggaattgggg ggagcgggca tggggaagca gtgtccaaag cactttggag gaggcctgcc      2400
     aggcttccta tggcctctga taccctcatg ctctgccctg agctgtttca ctatgggata      2460
     agaggttctg tgtccacatc ccaccggttc ccctcagcct cgtgaccagt gttcctgacc      2520
     ccagaacaga ccctagcctc tgcccaggaa aatctgtatc ttcctcctcc agacaaggtg      2580
     agggccccgg ggctgtacag tgttacttgt tggactgcac cactcagccc tgtttatttg      2640
     tgtaattatt ttttttttaa attgtattac ctgtggttgc catcccctgc cccagccttg      2700
     ggtccagtgt gtcttccagg cctgcctgca cctcacttgg ctgctccagg gtctctatcc      2760
     tttgttccaa ccctggttgt caggcccagc cagcaaaggc ccacgaccca gcagcctgcc      2820
     caaagcactt gtttatggag ggaaagaagg ggacttctct gtaggaagct tgagcccaga      2880
     gccctgggga aggggaccct gttccacatt cccttgccca ccctccacca ggtcggaggc      2940
     ccagtcttcc cagacgtgct aaccccattc aatgtgccaa atggcctcag tccatgtgcc      3000
     cgtcccccct ctgcagttcc tgcaccttct cccaagaccc gcagtccgtt tgtccgtcct      3060
     ctgtgccctc tgcagtgaca gccctggcca agccacttct aatcctctgt agcaataacg      3120
     gtgtgccgcc cgccgctgcc cagtgtgtgc agaactaggg ttttaaagtc cgtaggtttt      3180
     aatgaaattt ctattcctgt ctctgaaaaa aaaaaaaaaa aaaaaaa                    3227
//


spacer
spacer