spacer

EBI Dbfetch

ID   X65603; SV 1; linear; mRNA; STD; MUS; 1764 BP.
XX
AC   X65603; S41875;
XX
DT   18-AUG-1992 (Rel. 33, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 8)
XX
DE   M.musculus mRNA for GlcNAc-1-P transferase
XX
KW   GlcNAc-1-P transferase; transferase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1764
RA   Rajput B.;
RT   ;
RL   Submitted (21-APR-1992) to the INSDC.
RL   B. Rajput, Univ of Maryland, Dept of Animal Sc., College Park, MD 20742,
RL   USA
XX
RN   [2]
RP   1-1764
RX   PUBMED; 1323278.
RA   Rajput B., Ma J., Muniappa N., Schantz L., Naylor S.L., Lalley P.A.,
RA   Vijay I.K.;
RT   "Mouse UDP-GlcNAc: dolichyl-phosphate
RT   N-acetylglucosaminephosphotransferase. Molecular cloning of the cDNA,
RT   generation of anti-peptide antibodies and chromosomal localization.";
RL   Biochem. J. 285:985-992(1992).
XX
DR   MD5; 816b01fb9f9f2ab7141c50b3e966e7c0.
DR   Ensembl-Gn; ENSMUSG00000032123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054708; mus_musculus.
DR   EuropePMC; PMC18509; 10811900.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1764
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /mol_type="mRNA"
FT                   /dev_stage="mid-lactating"
FT                   /clone_lib="cDNA in lambda-gt11"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   mRNA            1..1764
FT   CDS             60..1292
FT                   /product="GlcNAc-1-P transferase"
FT                   /db_xref="GOA:P42867"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="MGI:MGI:1196396"
FT                   /protein_id="CAA46553.1"
FT                   /translation="MWAFPELPLPLPLLVNLIGSLLGFVATVTLIPAFRSHFIAARLCG
FT                   QDLNKLSQQQIPESQGVISGAVFLIILFYFIPFPFLNCFVEEQCKAFPHHEFVALIGAL
FT                   LAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVPKPFRWILGL
FT                   HLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLVELEGDYRDD
FT                   HIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFF
FT                   MPQVFNFLYSLPQLFHIIPCPRHRMPRLNAKTGKLEMSYSKFKTKNLSFLGTFILKVAE
FT                   NLRLVTVHQGESEDGAFTECNNMTLINLLLKVFGPIHERNLTLLLLLLQVLSSAATFSI
FT                   RYQLVRLFYDV"
XX
SQ   Sequence 1764 BP; 349 A; 519 C; 410 G; 486 T; 0 other;
     tgtgccgggt tgctagttag ctgagtaggc ggcggggcgg cggccaccgg agggtcacca        60
     tgtgggcctt cccggagttg cccctgccgc tgccgctgct ggtgaatttg atcggctcgc       120
     tgttgggatt cgtggctaca gtcaccctca tccctgcctt ccgtagccac tttatcgccg       180
     cgcgcctctg tggccaggac ctcaacaagc tcagccagca gcagatccca gagtcccagg       240
     gagtgatcag cggtgctgtt ttccttatca tcctcttcta cttcatccct ttccccttcc       300
     tgaactgctt cgtggaggag cagtgtaagg cattccccca ccatgaattt gtggccctaa       360
     taggtgccct ccttgccatc tgctgcatga tcttcctggg gtttgctgat gatgtcctca       420
     atctccgctg gcgccacaag ctgctgctgc ccacagctgc ctcactacct ctcctcatgg       480
     tctacttcac aaactttggc aatacaacca tcgtggtgcc caagcccttc cgctggattc       540
     tgggcctgca tttggacttg gggatcctgt actacgtcta catggggctg cttgcagtgt       600
     tctgtaccaa tgccatcaac atcctggcgg gcattaatgg cctagaggcc ggtcagtcac       660
     tagtcatctc tgcttctatc attgtcttca acctggtgga actggaaggt gattatcgag       720
     atgatcatat cttttccctt tacttcatga taccattttt ctttaccacc ttgggactgc       780
     tttaccacaa ctggtacccg tcccgcgtgt ttgtgggaga caccttctgt tactttgcgg       840
     gcatgacttt tgccgtggtg gggatcttgg gacacttcag caagaccatg ctgctcttct       900
     ttatgccaca agtattcaat ttcctctact cactgcctca gctcttccat atcatcccct       960
     gccctcgaca ccggatgccc agactcaacg caaagacagg caaactggaa atgagctatt      1020
     ccaagttcaa gaccaagaac ctctctttcc tgggcacctt tattttaaag gtagcagaga      1080
     acctccggtt agtgacagtt caccaaggtg agagtgagga cggtgccttc actgagtgta      1140
     acaacatgac cctcatcaac ttgctactta aagtctttgg gcctatacat gagagaaacc      1200
     tcaccctgct cctgctgctc ctgcaggtcc taagcagcgc cgccaccttc tccattcgtt      1260
     accaactcgt ccgactcttc tatgatgtct gagctccctg acagctgccc tttacctcac      1320
     agtctccatt ggacctcagc caggaccagc ctctgtctgg tccgagatga ccctctggtc      1380
     caggcctcgc tgacactttt gttctcagct tctgccatct gtgactactg atatcctgga      1440
     tggacacctt gctggacttg aagtccgcta gttggacttt gcctagggct ttcatcttgc      1500
     cttgccctcc ctttctgtcc catctgcagc ctcaccaggt gggcttgtag cctctattat      1560
     gcaaatattc gtagctcagc tttcagagcg ctaactctaa aggaattcac ctgagccttg      1620
     agagagaacc tgggctaggg ctagagttag ggctacatac tccaaggtga cctcacattt      1680
     gactatcaaa tgaagtgttg tgattgggaa gcgtagaggc agggcatgtg ctcagaacgg      1740
     tgacaataaa ggactgcctt ttac                                             1764
//


spacer
spacer