Dbfetch

ID   X63730; SV 1; linear; mRNA; STD; MUS; 896 BP.
XX
AC   X63730;
XX
DT   12-OCT-1993 (Rel. 37, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   M.musculus mRNA for SmN protein
XX
KW   SmN protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [2]
RP   1-896
RA   Gerelli D.;
RT   ;
RL   Submitted (24-FEB-1992) to the INSDC.
RL   D. Gerelli, The Medical Molecular Biology Unit, University London, The
RL   Windeyer Building, Cleveland Street, London, WIP 6DB, UK
XX
RN   [4]
RP   1-896
RA   Gerrelli D., Grimaldi K., Mahadeva U., Sharp N., Latchman D.S.;
RT   "The cardiac form of the tissue specific splicing protein SMN is identical
RT   to the brain and embryo forms of the protein";
RL   Unpublished.
XX
DR   MD5; 8ce7f7822b118416fd744241b8c86254.
DR   Ensembl-Gn; ENSMUSG00000102252; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032324; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032303; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032239; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032315; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032028; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032808; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031357; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031993; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032104; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032231; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031077; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031475; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084192; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084268; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084217; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084241; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083814; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084737; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083754; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083939; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083796; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083958; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083841; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085013; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083743; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082868; mus_musculus_wsbeij.
DR   EuropePMC; PMC398308; 7744013.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..896
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             108..830
FT                   /gene="SmN"
FT                   /db_xref="GOA:P63163"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63163"
FT                   /protein_id="CAA45273.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
XX
SQ   Sequence 896 BP; 220 A; 241 C; 225 G; 210 T; 0 other;
     acattgtttg ttaatagcct gcatcgaacc tttatttata tcccttcccc gagtattaag        60
     gatcttgaaa ttttagtgtt gacaaaggct attgtggaac agcaatcatg actgtgggta       120
     agagtagcaa gatgctgcag cacattgact ataggatgag atgtatcctg caagatggga       180
     gaatcttcat tggcaccttc aaggcttttg acaagcatat gaatttgatc ctctgtgatt       240
     gtgatgagtt caggaagatc aagccaaaga atgcaaaaca gccagaacgt gaagaaaaac       300
     gggttttggg tctggtcttg ctacgtgggg agaacttggt ttcaatgaca gtggagggcc       360
     cacctcctaa agatactggc attgctcgtg tgcctcttgc tggcgctgca ggtggccctg       420
     gggttggaag agcagctggc agaggagtgc cagcaggtgt acctattccc caagctcctg       480
     ctggattagc aggccctgtc cgaggagttg gaggcccatc ccagcaggtc atgaccccac       540
     agggaagagg cactgttgct gctgctgctg ttgctgctac tgctagcatt gcaggagccc       600
     caacccagta cccgccagga cggggaactc cacctccacc tgtaggcaga gcaaccccac       660
     ctccaggcat tatggctcct ccacctggaa tgagaccacc catgggccca ccaattggac       720
     ttccccctgc tcgaggtaca cctataggca tgcctcctcc aggaatgaga ccccccccac       780
     caggaattag aggcccacct cccccaggaa tgcgtccacc aagaccctaa gatacagttg       840
     ataaatctca gcccttctct tcccctacaa tgcttcttgt gaaattgtgt acctgc           896
//