Dbfetch

ID   X63535; SV 1; linear; mRNA; STD; MUS; 4072 BP.
XX
AC   X63535;
XX
DT   28-JUL-1992 (Rel. 32, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   M.musculus ufo mRNA
XX
KW   receptor; ufo gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4072
RA   Schulz A.S.;
RT   ;
RL   Submitted (16-DEC-1991) to the INSDC.
RL   A.S. Schulz, Section of Mol Biology, Dept of Pediatrics 2, Prittwitzstr 43,
RL   D-7900 Ulm, FRG
XX
RN   [2]
RX   PUBMED; 1320243.
RA   Faust M.W., Ebensperger C., Schulz A.S., Schleithoff L., Hameister H.,
RA   Bartram C.R., Janssen J.W.G.;
RT   "The murine ufo receptor: molecular cloning, chromosomal localization and
RT   in situ expression analysis";
RL   Oncogene 7(7):1287-1293(1992).
XX
DR   MD5; 788c258d6a9af59812104d17f7b704bb.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031858; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031787; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032327; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030924; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031549; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031703; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031656; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031782; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031693; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030648; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031027; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000002677; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082384; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0082456; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0082389; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082410; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082007; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082535; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0081955; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0082119; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0081992; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0082137; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082015; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083160; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081965; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081059; mus_musculus_wsbeij.
DR   EuropePMC; PMC2957826; 12036992.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4072
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt10"
FT                   /clone="pMF1.1"
FT                   /tissue_type="adult heart"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     5..58
FT                   /gene="ufo"
FT   CDS             5..2671
FT                   /gene="ufo"
FT                   /db_xref="GOA:Q00993"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00993"
FT                   /protein_id="CAA45097.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACV
FT                   LILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK
FT                   EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDF
FT                   LSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQP
FT                   VFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
FT                   DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIY
FT                   DYLRQGNRLKQPVDFLDGLYSLMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDE
FT                   ILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPT
FT                   LSADRGCPAPPGQEDGA"
FT   mat_peptide     59..2668
FT                   /gene="ufo"
FT   regulatory      4038..4042
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4058
XX
SQ   Sequence 4072 BP; 935 A; 1110 C; 1063 G; 964 T; 0 other;
     gaggatgggc agggtcccgc tggcctggtg gttggcgctg tgctgctggg ggtgtgcagc        60
     ccataaggac acacagaccg aggctggcag cccgtttgtg gggaacccag ggaatatcac       120
     aggtgccaga ggactcacgg ggacacttcg gtgtgagctc caggttcagg gggaaccccc       180
     tgaggtggtg tggcttcgag atggacagat cctagaactg gctgataaca cccagaccca       240
     ggtgcctctg ggcgaagact ggcaagatga atggaaagtt gtcagtcagc tcagaatctc       300
     agccctgcaa ctttcagatg caggggagta ccagtgtatg gtgcatctag aaggacggac       360
     ctttgtgtct cagccgggct ttgtagggct ggaaggtctc ccgtacttcc tggaggagcc       420
     tgaggacaaa gctgtgcctg ccaacacccc tttcaaccta agctgccagg cccagggacc       480
     cccggaaccc gtgaccctac tctggcttca agatgctgtc cccctggccc cagtcacagg       540
     acacagctcc cagcacagtc tgcaaactcc aggcctgaac aagacatctt ctttctcatg       600
     tgaagcccac aatgccaagg gagtcaccac ctcccgcaca gccaccatca cagtgctccc       660
     ccagaggcct caccatctcc acgtggtttc cagacaacct acggagctag aggtagcttg       720
     gacccctggc ctgagtggca tctacccgct cacccactgc aacctgcagg ccgtgctgtc       780
     agacgatggg gtgggtatct ggctgggaaa gtcagatcct cctgaagacc ccctcacctt       840
     gcaagtatca gtgccccccc accagcttcg gctggaaaag ctccttcctc acaccccgta       900
     tcacatccgg atatcctgca gcagcagcca gggcccctca ccttggaccc actggcttcc       960
     tgtggagacc acagagggag tgcccttggg tccccctgag aacgttagcg ccatgcggaa      1020
     tgggagccag gtcctcgtgc gttggcagga gccaagggtg cccctgcaag gcaccctgtt      1080
     agggtaccgg ctggcatatc gaggccagga cacccccgag gtacttatgg atatagggct      1140
     aactcgagag gtgaccttgg aactgcgggg ggacaggcct gtggctaacc tgactgtgtc      1200
     tgtgacagcc tatacctcgg ctggggatgg gccctggagc cttcctgtgc ccctagagcc      1260
     ctggcgccca gggcaaggac agccactcca ccatctggtg agtgaacccc cacctcgcgc      1320
     cttctcgtgg ccttggtggt atgtactgct gggagcactt gtggctgccg cctgcgtcct      1380
     catcttggcc ctgttccttg tccatcggag gaagaaggag actcgatatg gggaggtgtt      1440
     tgagccaacc gtggaaagag gtgaactggt agtcaggtac cgtgtccgaa agtcctacag      1500
     ccggcggacc actgaagcca ccttgaacag tctgggcatc agtgaagagc tgaaggagaa      1560
     actacgagac gtcatggtag atcggcataa ggtggccttg gggaagaccc tgggagaagg      1620
     agaatttggc gctgtgatgg aaggtcagct caatcaggat gactccatcc tcaaggtcgc      1680
     tgtgaagacc atgaaaattg ccatctgcac aagatcagag ctggaggatt tcctgagtga      1740
     agctgtctgc atgaaggaat ttgaccaccc caacgtcatg aggctcattg gcgtctgttt      1800
     tcagggctct gacagagagg gtttcccaga acctgtggtc atcttgcctt tcatgaaaca      1860
     cggagaccta cacagtttcc tcctgtactc ccggctcggg gaccagccag tgttcctgcc      1920
     cactcagatg ctagtgaagt tcatggccga cattgccagt ggtatggagt acctgagtac      1980
     caagagattc atacatcggg acctggctgc caggaactgc atgctgaatg agaacatgtc      2040
     cgtgtgtgtg gcagacttcg ggctctccaa gaagatctac aacggggatt actaccgcca      2100
     agggcgcatt gccaagatgc cagtcaagtg gattgctatt gagagtctgg cagatcgggt      2160
     ctacaccagc aagagcgatg tgtggtcctt cggtgtgaca atgtgggaga tcgccacccg      2220
     aggccaaact ccctatccag gggtggagaa cagtgagatt tacgactacc tgcgtcaagg      2280
     aaatcggctg aaacagcctg tggactttct ggacggcctg tattccctga tgtctcggtg      2340
     ctgggaactg aaccctcgag accggccaag ttttgcggag ctccgggaag acttggagaa      2400
     cacactgaag gctctgcccc ctgctcagga gccagatgaa atcctctatg tcaacatgga      2460
     tgagggcgga agccaccttg aaccccgtgg ggctgctgga ggagctgacc ccccaaccca      2520
     acctgatcct aaggattcct gtagctgtct cactgcagct gacgtccact cagctggacg      2580
     ctatgtcctt tgtccttcta cagccccagg acccactctg tctgctgaca gaggctgccc      2640
     agcacctcca gggcaggagg acggagcctg agacaatctt ccacctggga catcctctca      2700
     ggacccaagc taggcactgc cactggggga aagctcaccc ccccactccg tcactccagg      2760
     ccttctcccc agatgcagaa tggccttccc tcccttctca gatgcagtcc atgccttatg      2820
     caccctatcc ataacagttt caagggatcg tctcacatct tccatcccag cgttctagat      2880
     tttaaggttt gagtttagag ttcaaagttc tcaaagatga tgagtctttg gaccgagatg      2940
     cttgtttcta ggtctgcagc gctgttgcta tagacaggcc cactgctcga aggctctgag      3000
     attctatggc tctagatttt tctggctcta taattcgtgg caatgctccc atggttttag      3060
     gttgcacgac tctgagattc caggacctaa ggcttctaga ctttattttt ctggagccag      3120
     gggtcctgtc agtggaagat tgtagatttt taaattctaa agattctagg catgaaggtt      3180
     ctaaggcata ctgcttctcc agtttaacag tttagggctc atgttggaat actccagatc      3240
     ataatgtttc aaacttttat tttttttaat ttctaagacc ccagtgatgg tcaactacag      3300
     attctgaagc cttatgacca tagattcttt tatataaaaa tcctgtatct caaggaaata      3360
     tgattctaga ctctgaaatt ccaaagcttt aagagtctcc agatggagtt tctaagctat      3420
     gatgtggtga taatctaaag tttagtccaa ggttctagat tcctaagctt ccacgtcatc      3480
     tgctcccagg attccagatt attaaactct aaaactctaa tgttggcctg atcttcgtct      3540
     caggccctgt aggatgctgt gggtcctcag catctaagtc acaagaggct ccagttaacg      3600
     aggactaatg agacaccaaa gttctaacca cttctaatgc tggacacctc taggttctat      3660
     gctgcttttt gcctttctag cacataatta aatgcccaag aatacatatg tctaaagatc      3720
     ttaaatctct aagcactatg gagccaatgt tttgagtgtc tgagattcta aaggtccaca      3780
     gtctagagta ttaggtacga ctccagggtg ggcgcttgta gccatcctaa gtcctttccc      3840
     tccttaagca cctatgctcc tcctctcctt gtgtggggta caccccacct taagcctgtg      3900
     cgatgcactg ggaatgcctg ctttcctcca agggatgggt catctcccct catttggggc      3960
     catgttgccc cttgagccag tcccctatgc ctgttctgaa gtgtggactc tggtgcctcc      4020
     agagaggctc agatcacata aaacttttgt cagtcactaa aaaaaaaaaa aa              4072
//