spacer

EBI Dbfetch

ID   X62648; SV 1; linear; mRNA; STD; MUS; 993 BP.
XX
AC   X62648;
XX
DT   10-DEC-1991 (Rel. 30, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   M.musculus mRNA for SmN protein
XX
KW   SmN gene; tissue specific splicing protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-993
RA   Gerrelli D.;
RT   ;
RL   Submitted (10-OCT-1991) to the INSDC.
RL   D. Gerrelli, The Medical Molecular Biology Unit, University College &
RL   Middlesex School of Medicine, The Windeyer Building, Cleveland Street,
RL   London W1P 6DB, UK
XX
RN   [2]
RX   DOI; 10.1093/nar/19.23.6642.
RX   PUBMED; 1754402.
RA   Gerrelli D., Sharp N.G., Latchman D.S.;
RT   "Cloning and sequencing of a mouse embryonal carcinoma cell mRNA encoding
RT   the tissue specific RNA splicing protein SmN";
RL   Nucleic Acids Res. 19(23):6642-6642(1991).
XX
DR   MD5; 5b717c37c74df7ba45e7ec386e15f8d3.
DR   Ensembl-Gn; ENSMUSG00000000948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
DR   EuropePMC; PMC1688426; 9178545.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..993
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /clone_lib="EC gt11"
FT                   /cell_line="EC"
FT                   /cell_type="pluripotent mouse embryonal carcinomal cell"
FT                   /db_xref="taxon:10090"
FT   mRNA            1..993
FT                   /gene="SmN"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             155..877
FT                   /gene="SmN"
FT                   /product="tissue specific splicing protein"
FT                   /db_xref="GOA:P63163"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63163"
FT                   /protein_id="CAA44517.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
XX
SQ   Sequence 993 BP; 248 A; 264 C; 241 G; 240 T; 0 other;
     aaggaaaaca ggacccatcc tctgtctgta aactttggtc aagcttacat tgtttgttaa        60
     tagccctgca tcgaaccttt atttatatcc cttccccgag tattaaggat cttgaaattt       120
     tagtgttgac aacggctatt gtggaacagc aatcatgact gtgggtaaga gtagcaagat       180
     gctgcagcac attgactata ggatgagatg tatcctgcaa gatggaagga tcttcattgg       240
     caccttcaag gcttttgaca agcatatgaa tttgatcctc tgtgattgtg atgagttcag       300
     gaagatcaag ccaaagaatg caaaacagcc agaacgtgaa gaaaaacggg ttttgggtct       360
     ggtcttgcta cgtggggaga acttggtttc aatgactgtg gagggcccac ctcctaaaga       420
     tactggcatt gctcgtgtgc ctcttgctgg cgctgcaggt ggccctgggg ttggaagagc       480
     agctggcaga ggagtgccag caggtgtacc tattccccaa gctcctgctg gattagcagg       540
     ccctgtccga ggagttggag gcccatccca gcaggtcatg accccacagg gaagaggcac       600
     tgttgctgct gctgctgttg ctgctactgc tagcattgca ggagccccaa cccagtaccc       660
     gccaggacgg ggaactccac ctccacctgt aggcagagca accccacctc caggcattat       720
     ggctcctcca cctggtatga gaccacccat gggcccacca attggacttc cccctgctcg       780
     tgggacacct ataggcatgc ctcctccagg aatgagaccc cctccaccag gaattagagg       840
     cccacctccc ccaggaatgc gcccaccaag accctaagat acagttgata aatctcagcc       900
     cttctcttcc cctacaatgc ttcttgtgaa attgtgtacc tgcaagcttt tgacccctct       960
     tactgcatta actatagata ataaatcata gag                                    993
//


spacer
spacer