Dbfetch

ID   X59560; SV 1; linear; genomic DNA; STD; MUS; 4126 BP.
XX
AC   X59560;
XX
DT   18-NOV-1991 (Rel. 30, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   M.musculus gene for tyrosine kinase receptor
XX
KW   tyrosine kinase receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RC   revised by [3]   MAT
RA   Mansukhani A.;
RT   ;
RL   Submitted (22-MAY-1991) to the INSDC.
RL   A. Mansukhani, New York School of Medicine, Dept of Microbiology, 550 First
RL   Avenue, New York NY 10016, USA
XX
RN   [2]
RX   PUBMED; 1840679.
RA   Rescigno J., Mansukhani A., Basilico C.;
RT   "A putative receptor tyrosine kinase with unique structural topology";
RL   Oncogene 6(10):1909-1913(1991).
XX
RN   [3]
RP   1-4126
RA   Mansukhani A.;
RT   ;
RL   Submitted (03-MAR-1994) to the INSDC.
RL   A. Mansukhani, New York School of Medicine, Dept of Microbiology, 550 First
RL   Avenue, New York NY 10016, USA
XX
DR   MD5; 790c2af665c3deaca08426b4e9c8bc46.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031858; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031787; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032327; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030924; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031549; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031703; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031656; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031782; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031693; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030648; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031027; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000002677; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082384; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0082456; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0082389; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082410; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082007; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082535; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0081955; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0082119; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0081992; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0082137; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082015; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083160; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081965; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081059; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4126
FT                   /organism="Mus musculus"
FT                   /map="q13.1-13.2"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="cDNA"
FT                   /cell_line="A-15"
FT                   /cell_type="NIH3T3 cells transformed by K-FGF oncogene"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..59
FT   sig_peptide     60..115
FT   CDS             60..2726
FT                   /product="tyrosine kinase receptor"
FT                   /db_xref="GOA:Q00993"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00993"
FT                   /protein_id="CAA42158.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVRNLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACV
FT                   LILALFLVHRRKKETRYGEVFEPTVERPELVVRYRVRKSYSRRTTEATLNSLGISEELK
FT                   EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIVICTRSELEDF
FT                   LSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQP
FT                   VFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
FT                   DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIY
FT                   DYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDE
FT                   ILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPT
FT                   LSADRGCPAPPGQEDGA"
FT   mat_peptide     116..2723
FT                   /product="tyrosine kinase receptor"
FT   misc_feature    147..705
FT                   /product="two Ig-like domains"
FT   misc_feature    708..1315
FT                   /product="two fibronectin-like domains"
FT   misc_feature    1394..1457
FT                   /product="transmembrane region"
FT   misc_feature    1641..2471
FT                   /product="tyrosine kinase domain"
FT   3'UTR           2889..4125
XX
SQ   Sequence 4126 BP; 948 A; 1120 C; 1076 G; 982 T; 0 other;
     gaattccatc aacttcggaa gaaagtttgg catcaatctg agctgttggt gtctggagga        60
     tgggcagggt cccgctggcc tggtggttgg cgctgtgctg ctgggggtgt gcagcccata       120
     aggacacaca gaccgaggct ggcagcccgt ttgtggggaa cccagggaat atcacaggtg       180
     ccagaggact cacggggaca cttcggtgtg agctccaggt tcagggggaa ccccctgagg       240
     tggtgtggct tcgagatgga cagatcctag aactggctga taacacccag acccaggtgc       300
     ctctgggcga agactggcaa gatgaatgga aagttgtcag tcagctcaga atctcagccc       360
     tgcaactttc agatgcaggg gagtaccagt gtatggtgca tctagaagga cggacctttg       420
     tgtctcagcc gggctttgta gggctggaag gtctcccgta cttcctggag gagcctgagg       480
     acaaagctgt gcctgccaac acccctttca acctaagctg ccaggcccag ggacccccgg       540
     aacccgtgac cctactctgg cttcaagatg ctgtccccct ggccccagtc acaggacaca       600
     gctcccagca cagtctgcaa actccaggcc tgaacaagac atcttctttc tcatgtgaag       660
     cccacaatgc caagggagtc accacctccc gcacagccac catcacagtg ctcccccaga       720
     ggcctcacca tctccacgtg gtttccagac aacctacgga gctagaggta gcttggaccc       780
     ctggcctgag tggcatctac ccgctcaccc actgcaacct gcaggccgtg ctgtcagacg       840
     atggggtggg tatctggctg ggaaagtcag atcctcctga agaccccctc accttgcaag       900
     tatcagtgcc cccccaccag cttcggctgg aaaagctcct tcctcacacc ccgtatcaca       960
     tccggatatc ctgcagcagc agccagggcc cctcaccttg gacccactgg cttcctgtgg      1020
     agaccacaga gggagtgccc ttgggtcccc ctgagaacgt tagcgccatg cggaatggga      1080
     gccaggtcct cgtgcgttgg caggagccaa gggtgcccct gcaaggcacc ctgttagggt      1140
     accggctggc atatcgaggc caggacaccc ccgaggtact tatggatata gggctaactc      1200
     gagaggtgac cttggaactg cggggggaca ggcctgtgcg taacctgact gtgtctgtga      1260
     cagcctatac ctcggctggg gatgggccct ggagccttcc tgtgccccta gagccctggc      1320
     gcccagggca aggacagcca ctccaccatc tggtgagtga acccccacct cgcgccttct      1380
     cgtggccttg gtggtatgta ctgctgggag cacttgtggc tgccgcctgc gtcctgatct      1440
     tggccctgtt ccttgtccat cggaggaaga aggagactcg atatggggag gtgtttgagc      1500
     caaccgtgga aagacctgaa ctggtagtca ggtaccgtgt ccgaaagtcc tacagccggc      1560
     ggaccactga agccaccttg aacagtctgg gcatcagtga agagctgaag gagaaactac      1620
     gagacgtcat ggtagatcgg cataaggtgg ccttggggaa gaccctggga gaaggagaat      1680
     ttggcgctgt gatggaaggt cagctcaatc aggatgactc catcctcaag gtcgctgtga      1740
     agaccatgaa aattgtcatc tgcacaagat cagagctgga ggatttcctg agtgaagctg      1800
     tctgcatgaa ggaatttgac caccccaacg tcatgaggct cattggcgtc tgttttcagg      1860
     gctctgacag agagggtttc ccagaacctg tggtcatctt gcctttcatg aaacacggag      1920
     acctacacag tttcctcctg tactcccggc tcggggacca gccagtgttc ctgcccactc      1980
     agatgctagt gaagttcatg gccgacattg ccagtggtat ggagtacctg agtaccaaga      2040
     gattcataca tcgggacctg gctgccagga actgcatgct gaatgagaac atgtccgtgt      2100
     gtgtggcaga cttcgggctc tccaagaaga tctacaacgg ggattactac cgccaagggc      2160
     gcattgccaa gatgccagtc aagtggattg ctattgagag tctggcagat cgggtctaca      2220
     ccagcaagag cgatgtgtgg tccttcggtg tgacaatgtg ggagatcgcc acccgaggcc      2280
     aaactcccta tccaggggtg gagaacagtg agatttacga ctacctgcgt caaggaaatc      2340
     ggctgaaaca gcctgtggac tgtctggacg gcctgtatgc cctgatgtct cggtgctggg      2400
     aactgaaccc tcgagaccgg ccaagttttg cggagctccg ggaagacttg gagaacacac      2460
     tgaaggctct gccccctgct caggagccag atgaaatcct ctatgtcaac atggatgagg      2520
     gcggaagcca ccttgaaccc cgtggggctg ctggaggagc tgacccccca acccaacctg      2580
     atcctaagga ttcctgtagc tgtctcactg cagctgacgt ccactcagct ggacgctatg      2640
     tcctttgtcc ttctacagcc ccaggaccca ctttgtctgc tgacagaggc tgcccagcac      2700
     ctccagggca ggaggacgga gcctgagaca atcttccacc tgggacatcc tctcaggacc      2760
     caagctaggc actgccactg ggggaaagct caccccccca ctccgtcact ccaggccttc      2820
     tccccagatg cagaatggcc ttccctccct tctcagatgc agtccatgcc ttatgcaccc      2880
     tatccataac agtttcaagg gatcgtctca catcttccat cccagcgttc tagattttaa      2940
     ggtttgagtt tagagttcaa agttctcaaa gatgatgagt ctttggaccg agatgcttgt      3000
     ttctaggtct gcagcgctgt tgctatagac aggcccactg ctcgaaggct ctgagattct      3060
     atggctctag atttttctgg ctctataatt cgtggcaatg ctcccatggt tttaggttgc      3120
     acgactctga gattccagga cctaaggctt ctagacttta tttttctgga gccaggggtc      3180
     ctgtcagtgg aagattgtag atttttaaat tctaaagatt ctaggcatga aggttctaaa      3240
     ggcatactgc ttctccagtt taacagttta gggctcatgt tggaatactc cagatcataa      3300
     tgtttcaaac ttttattttt tttaatttct aagaccccag tgatggtcaa ctacagattc      3360
     tgaagcctta tgaccataga ttcttttata taaaaatcct gtatctcaag aaatatgatt      3420
     ctagactctg aaattccaaa gctttaagag tctccagatg gagtttctaa gctatgatgt      3480
     ggtgataatc taaagttagt ccaaggttct agattcctaa gcttccacgt catctgctcc      3540
     caggattcca gattattaaa ctctaaaact ctaatgttgg cctgatcttc gtctcaggcc      3600
     ctgtaggatg ctgtgggtcc tcagcatcta agtcacaaga ggctccagtt aacgaggact      3660
     aatgagacac caaagttcta accacttcta atgctggaca cctctaggtt ctatgctgct      3720
     ttttgccttt ctagcacata attaaatgcc caagaataca tatgtctaaa gatcttaaat      3780
     ctctaagcac tatggagcca atgttttgag tgtctgagat tctaaaggtc cacagtctag      3840
     agtattaggt acgactccaa gggtgggcgc ttgtagccat cctaagtcct ttccctcctt      3900
     aagcacctat gctcctcctc tccttgttgg gtacacccca ccttaagcct gtgcgatgca      3960
     ctgggaatgc ctgctttcct ccaagggatg ggtcatctcc cctcatttgg gccatgttgc      4020
     cccttgagcc agtcccctat gcctgttctg aagtgtggac tctggtgcct ccagagaggc      4080
     tcagatcaca taaaactttt gtcagtcact aaaaaaaaag gaattc                     4126
//