spacer

EBI Dbfetch

ID   X57347; SV 1; linear; mRNA; STD; HUM; 1874 BP.
XX
AC   X57347;
XX
DT   14-DEC-1992 (Rel. 34, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   H.sapiens mRNA for HS1 protein
XX
KW   kinase related protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1874
RA   Leffers H.;
RT   ;
RL   Submitted (23-JAN-1991) to the INSDC.
RL   H. Leffers, University of Aahrus, Institute of Medical Biochemistry,
RL   Universitetsparken Bygn 170, DK 8000 Aahrus C, DENMARK
XX
RN   [3]
RP   1-1874
RX   DOI; 10.1006/jmbi.1993.1346.
RX   PUBMED; 8515476.
RA   Leffers H., Madsen P., Honore B., Rasmussen H.H., Andersen A.H., Walbum E.,
RA   Vandekerckhove J., Celis J.E.;
RT   "Molecular cloning and expression of the transformation sensitive
RT   epithelial marker stratifin. A member of a protein family that has been
RT   involved in the protein kinase C signalling pathway";
RL   J. Mol. Biol. 231(4):982-998(1993).
XX
DR   MD5; 37b2eaa43ac85f250d56c3e5453c780d.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   The protein is related to the protein kinase C inhibitory
CC   protein (KCIP) and protein 14-3-3, an activator of tyrosine and
CC   tryptophan hydroxylases. It is expressed in all the cell lines
CC   and tissues being assayed. See accession numbers x57345-48
CC   
CC   X56468 and X57347 are related sequences.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1874
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda ZAP II cDNA library"
FT                   /clone="HS1"
FT                   /cell_line="SV40 transformed MRC-5 fibroblasts (MRC-5 V2)"
FT                   /db_xref="taxon:9606"
FT   CDS             101..838
FT                   /gene="HS1"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000322081.13"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="CAA40622.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
FT   regulatory      1833..1838
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1855
XX
SQ   Sequence 1874 BP; 534 A; 419 C; 403 G; 518 T; 0 other;
     ggccgcggag acgtgaagct ctcgaggctc ctcccgctgc gggtcggcgc tcgccctcgc        60
     tctcctcgcc ctccgccccg gccccggccc cgcgcccgcc atggagaaga ctgagctgat       120
     ccagaaggcc aagctggccg agcaggccga gcgctacgac gacatggcca cctgcatgaa       180
     ggcagtgacc gagcagggcg ccgagctgtc caacgaggag cgcaacctgc tctccgtggc       240
     ctacaagaac gtggtcgggg gccgcaggtc cgcctggagg gtcatctcta gcatcgagca       300
     gaagaccgac acctccgaca agaagttgca gctgattaag gactatcggg agaaagtgga       360
     gtccgagctg agatccatct gcaccacggt gctggaattg ttggataaat atttaatagc       420
     caatgcaact aatccagaga gtaaggtctt ctatctgaaa atgaagggtg attacttccg       480
     gtaccttgct gaagttgcgt gtggtgatga tcgaaaacaa acgatagata attcccaagg       540
     agcttaccaa gaggcatttg atataagcaa gaaagagatg caacccacac acccaatccg       600
     cctggggctt gctcttaact tttctgtatt ttactatgag attcttaata acccagagct       660
     tgcctgcacg ctggctaaaa cggcttttga tgaggccatt gctgaacttg atacactgaa       720
     tgaagactca tacaaagaca gcaccctcat catgcagttg cttagagaca acctaacact       780
     ttggacatca gacagtgcag gagaagaatg tgatgcggca gaaggggctg aaaactaaat       840
     ccatacaggg tgtcatcctt ctttccttca agaaaccttt ttacacatct ccattcctta       900
     ttccacttgg atttcctata gcaaagaaac ccattcatgt gtatggaatc aactgtttat       960
     agtcttttca cactgcagct ttgggaaaac ttcattcctt gatttgtgtt tgtcttggcc      1020
     ttcctggtgt gcagtactgc tgtagaaaag tattaatagc ttcatttcat ataaacataa      1080
     gtaactccca aacacttatg tagaggacta aaaatgtatc tggtatttaa gtaatctgaa      1140
     ccagttctgc aagtgactgt gttttgtatt actgtgaaaa taagaaaatg tagttaatta      1200
     caatttaaag agtattccac ataacttctt aatttctaca ttccctccct tactcttcgg      1260
     gggtttcctt tcagtaagca acttttccat gctcttaatg tattcctttt tagtaggaat      1320
     ccggaagtat tagattgaat ggaaaagcac ttgccatctc tgtctagggg tcacaaattg      1380
     aaatggctcc tgtatcacat acggaggtct tgtgtatctg tggcaacagg gagtttcctt      1440
     attcactctt tatttgctgc tgtttaagtt gccaacctcc cctcccaata aaaattcact      1500
     tacacctcct gcctttgtag ttctggtatt cactttacta tgtgatagaa gtgcatgttg      1560
     ctgccagaat acaagcattg cttttggcaa attaaagtgc atgtcatttc ttaatacact      1620
     agaaagggga aataaattaa agtacacaag tccaagtcta aaactttagt acttttccat      1680
     gcagatttgt gcacatgtga gagggtgtcc agtttgtcta gtgattgtta tttagagagt      1740
     tggaccacta ttgtgtgttg ctaatcattg actgtagtcc caaaaaagcc ttgtgaaaat      1800
     gttatgccct atgtaacagc agagtaacat aaaataaaag tacattttat aaaccaaaaa      1860
     aaaaaaaaaa aaaa                                                        1874
//


spacer
spacer