Dbfetch

ID   X56468; SV 1; linear; mRNA; STD; HUM; 1862 BP.
XX
AC   X56468;
XX
DT   31-MAY-1991 (Rel. 28, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Human mRNA for 14.3.3 protein, a protein kinase regulator
XX
KW   protein kinase regulator.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1862
RA   Nielsen P.J.;
RT   ;
RL   Submitted (06-NOV-1990) to the INSDC.
RL   P.J. Nielsen, MAX PLANCK INSTITUT FUER IMMUNBIOLOGIE, STEUBEWEG 51, 7800
RL   FREIBURG, GERMANY
XX
RN   [4]
RP   1-1862
RX   DOI; 10.1016/0167-4781(91)90136-A.
RX   PUBMED; 2015305.
RA   Nielsen P.J.;
RT   "Primary structure of a human protein kinase regulator protein";
RL   Biochim. Biophys. Acta 1088(3):425-428(1991).
XX
DR   MD5; ebdedfc2f58220fe93b329383d470bbc.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
DR   EuropePMC; PMC2039936; 11984006.
DR   EuropePMC; PMC2172641; 12527748.
DR   EuropePMC; PMC548435; 15708996.
XX
CC   abundant acidic protein in the brain; activates tyrosine and
CC   tryptophan hydroxylases in the presence of
CC   Ca2+/calmodulin-dependent protein kinase II
CC   
CC   X56468 and X57347 are related sequences.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1862
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="mature T-cell lymphoma"
FT                   /clone_lib="lambda-gt11, cDNA"
FT                   /cell_line="Jurkat"
FT                   /cell_type="T-cell"
FT                   /tissue_type="lymphoid"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..1862
FT                   /note="14.3.3 protein"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             126..863
FT                   /product="14.3.3 protein"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000322023.13"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="PDB:5IQP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="CAA39840.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
FT   regulatory      1514..1519
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1659..1664
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1862 BP; 506 A; 428 C; 413 G; 515 T; 0 other;
     gtggtgggac tcgcgtcgcg gccgcggaga cgtgaagctc tcgaggctcc tcccgctgcg        60
     ggtcggcgct cgccctcgct ctcctcgccc tccgccccgg ccccggcccc ggccccgcgc       120
     ccgccatgga gaagactgag ctgatccaga aggccaagct ggccgagcag gccgagcgct       180
     acgacgacat ggccacctgc atgaaggcag tgaccgagca gggcgccgag ctgtccaacg       240
     aggagcgcaa cctgctctcc gtggcctaca agaacgtggt cgggggccgc aggtccgcct       300
     ggagggtcat ctctagcatc gagcagaaga ccgacacctc cgacaagaag ttgcagctga       360
     ttaaggacta tcgggagaaa gtggagtccg agctgagatc catctgcacc acggtgctgg       420
     aattgttgga taaatattta atagccaatg caactaatcc agagagtaag gtcttctatc       480
     tgaaaatgaa gggtgattac ttccggtacc ttgctgaagt tgcgtgtggt gatgatcgaa       540
     aacaaacgat agataattcc caaggagctt accaagaggc atttgatata agcaagaaag       600
     agatgcaacc cacacaccca atccgcctgg ggcttgctct taacttttct gtattttact       660
     atgagattct taataaccca gagcttgcct gcacgctggc taaaacggct tttgatgagg       720
     ccattgctga acttgataca ctgaatgaag actcatacaa agacagcacc ctcatcatgc       780
     agttgcttag agacaaccta acactttgga catcagacag tgcaggagaa gaatgtgatg       840
     cggcagaagg ggctgaaaac taaatccata cagggtgtca tccttctttc cttcaagaaa       900
     cctttttaca catctccatt ccttattcca cttggatttc ctatagcaaa gaaacccatt       960
     catgtgtatg gaatcaactg tttatagtct tttcacactg cagctttggg aaaacttcat      1020
     tccttgattt gtgtttgtct tggccttcct ggtgtgcagt actgctgtag aaaagtatta      1080
     atagcttcat ttcatataaa cataagtaac tcccaaacac ttatgtagag gactaaaaat      1140
     gtatctggta tttaagtaat ctgaaccagt tctgcaagtg actgtgtttt gtattactgt      1200
     gaaaataaga aaatgtagtt aattacaatt taaagagtat tccacataac ttcttaattt      1260
     ctacattccc tcccttactc ttcgggggtt tcctttcagt aagcaacttt tccatgctct      1320
     taatgtattc ctttttagta ggaatccgga agtattagat tgaatggaaa agcacttgcc      1380
     atctctgtct aggggtcaca aattgaaatg gctcctgtat cacataccgg aggtcttgtg      1440
     tatctgtggc caacagggag tttccttatt cactctttat ttgctgctgt ttaagttgcc      1500
     aacctcccct cccaataaaa attcacttac acctcctgcc tttgtagttc tggtattcac      1560
     tttactatgt gatagaagta gcatgttgct gccagaatac aagcattgct tttggcaaat      1620
     taaagtgcat gtcatttctt aatacactag aaaggggaaa taaattaaag tacacaagtc      1680
     caagtctaaa actttagtac ttttcccatg cagatttgtg cacatgtgag agggtgtcca      1740
     gtttgtctag tgattgttat ttagagagtt ggaccactat tgtgtgttgc taatcattga      1800
     ctgtagtccc aaaaaagcct tgtgaaaatg ttatgcccta tgtaacagca gagtaacata      1860
     aa                                                                     1862
//