Dbfetch

ID   X16642; SV 1; linear; mRNA; STD; MUS; 1402 BP.
XX
AC   X16642;
XX
DT   12-DEC-1989 (Rel. 22, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse Ren 1 mRNA for preprorenin
XX
KW   Ren 1 gene; renin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1402
RA   Nakayama K.;
RT   ;
RL   Submitted (27-SEP-1989) to the INSDC.
RL   Nakayama K., Institute of Biological Sciences, University of Tsukuba,
RL   Tsukuba, Ibaraki 305, Japan.
XX
RN   [2]
RP   1-1402
RX   DOI; 10.1093/nar/17.22.9279.
RX   PUBMED; 2685761.
RA   Kim W.S., Murakami K., Nakayama K.;
RT   "Nucleotide sequence of a cDNA coding for mouse Ren1 preprorenin";
RL   Nucleic Acids Res. 17(22):9480-9480(1989).
XX
DR   MD5; ffe993b9f5ffa340403ab6594d0f2596.
DR   Ensembl-Gn; ENSMUSG00000070645; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016485; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016468; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016428; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016254; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016889; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015834; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016228; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016333; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0016404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016357; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016925; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015620; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015896; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000094556; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022138; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022106; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022078; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021884; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022591; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021414; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0021831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0021956; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0022058; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0021942; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022625; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021461; mus_musculus_wsbeij.
DR   EuropePMC; PMC310828; 10673283.
DR   EuropePMC; PMC335157; 2685761.
DR   RFAM; RF00180; REN-SRE.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1402
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             15..1223
FT                   /note="preprorenin (AA -21 to 402)"
FT                   /db_xref="GOA:P06281"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012848"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR034135"
FT                   /db_xref="MGI:MGI:97898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06281"
FT                   /protein_id="CAA34636.1"
FT                   /translation="MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILE
FT                   ERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTG
FT                   SANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTV
FT                   GGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVF
FT                   SVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEG
FT                   CAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYT
FT                   LSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFA
FT                   LAR"
FT   sig_peptide     15..77
FT                   /note="signal peptide (AA -21 to -1)"
FT   misc_feature    78..206
FT                   /note="propeptide (AA 1-43)"
FT   mat_peptide     207..1220
FT                   /note="mature renin (AA 44-402)"
XX
SQ   Sequence 1402 BP; 306 A; 410 C; 362 G; 324 T; 0 other;
     cttggctgaa ccagatggac agaaggagga tgcctctctg ggcactcttg ttgctctgga        60
     gtccttgcac cttcagtctc ccaacacgca ccgctacctt tgaacgaatc ccgctcaaga       120
     aaatgccttc tgtccgggaa atcctggagg agcggggagt ggacatgacc aggctcagtg       180
     ctgaatgggg cgtattcaca aagaggcctt ccttgaccaa tcttacctcc cccgtggtcc       240
     tcaccaacta cctgaatacc cagtactacg gcgagattgg catcggtacc ccaccccaga       300
     ccttcaaagt catctttgac acgggttcag ccaacctctg ggtgccctcc accaagtgca       360
     gccgcctcta ccttgcttgt gggattcaca gcctctatga gtcctctgac tcctccagct       420
     acatggagaa cgggtccgac ttcaccatcc actacggatc agggagagtc aaaggtttcc       480
     tcagccagga ctcggtgact gtgggtggaa tcactgtgac acagaccttt ggagaggtca       540
     ccgagctgcc cctgatccct ttcatgctgg ccaagtttga cggtgttcta ggcatgggct       600
     ttcccgctca ggccgttggc ggggttaccc ctgtctttga ccacattctc tcccaggggg       660
     tgctaaagga ggaagtgttc tctgtctact acaacagggg ttcccacctg ctggggggcg       720
     aggtggtgct aggaggtagc gacccgcagc attatcaagg caattttcac tatgtgagca       780
     tcagcaagac tgactcctgg cagatcacga tgaagggggt gtctgtgggg tcttccaccc       840
     tgctatgtga agaaggctgt gcggtagtgg tggacactgg ttcatccttt atctcggctc       900
     ctacgagctc cctgaagttg atcatgcaag ccctgggagc caaggagaag agaatagaag       960
     aatatgttgt gaactgtagc caggtgccca ccctccccga catttccttt gacctgggag      1020
     gcagggccta cacactcagc agtacggact acgtgctaca gtatcccaac aggagagaca      1080
     agctgtgcac actggctctc catgccatgg acatcccacc acccactggg cctgtctggg      1140
     tcctgggtgc caccttcatc cgcaagttct atacagagtt tgatcggcat aacaatcgca      1200
     ttggattcgc cttggcccgc taaggccctc tgccacccag taaccctagg ccaagccaag      1260
     ctggcagtcc tgggggccat tttgtctggc tttgtcccca acatagggac actggacaca      1320
     gagaccctaa cgagtgtttg ccccttcacc tgcactcacc cttccctgct ttaaggaaaa      1380
     atcgaataaa gatttcatgt tt                                               1402
//