Dbfetch

ID   X15643; SV 1; linear; genomic DNA; STD; MUS; 4928 BP.
XX
AC   X15643;
XX
DT   22-MAR-1991 (Rel. 27, Created)
DT   22-MAR-1991 (Rel. 27, Last updated, Version 1)
XX
DE   Mouse gene for beta-2-adrenergic receptor
XX
KW   adrenergic receptor; beta-2 adrenergic receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4928
RX   PUBMED; 2549959.
RA   Nakada M.T., Haskell K.M., Ecker D.J., Stadel J.M., Crooke S.T.;
RT   "Genetic regulation of beta 2-adrenergic receptors in 3T3-L1 fibroblasts";
RL   Biochem. J. 260(1):53-59(1989).
XX
DR   MD5; 24d01f54d4bf7736066959e7c07f9387.
DR   EPD; EP29017; MM_B2AR.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024455; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024425; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024454; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024222; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024901; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023695; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024192; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024322; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024406; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024948; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023438; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023759; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049845; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049827; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049790; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049783; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050272; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049641; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049450; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049544; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049521; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049673; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049516; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049239; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048812; mus_musculus_wsbeij.
DR   EuropePMC; PMC117565; 11756681.
DR   EuropePMC; PMC23052; 10535984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4928
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda gt10"
FT                   /cell_line="3T3-L1"
FT                   /cell_type="fibroblast"
FT                   /db_xref="taxon:10090"
FT   CDS             2212..3468
FT                   /product="beta-2-andrenergic receptor"
FT                   /db_xref="GOA:P18762"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000332"
FT                   /db_xref="InterPro:IPR002233"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:87938"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18762"
FT                   /protein_id="CAA33664.1"
FT                   /translation="MGPHGNDSDFLLAPNGSRAPHHDVTQERDEAWVVGMAILMSVIVL
FT                   AIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHTSMKMWNFGNF
FT                   WCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGL
FT                   TSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRV
FT                   FQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGT
FT                   FTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELL
FT                   CLRRSSFETYGNGYSSNSNGRTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTV
FT                   PSLSVDSQGRNCSTNDSPL"
XX
SQ   Sequence 4928 BP; 1196 A; 1197 C; 1164 G; 1371 T; 0 other;
     ttccaggaca gctggggctc cacgagagaa accctgcctc ccccccaaaa atggcccaaa        60
     gttcactgac aaactcacat ttgtctgata tttagctatg taacagcact tacggtagca       120
     atagaatttg attctcactc atcacaatga aaatggctgg cgctctctct ctccctctct       180
     ccccatttca aatctgcaag cacacccctt agagatggag agaatttgat ccattggaga       240
     atcgagctaa aaataccacc atggaattgt gggaaggatt aaatgcaata atgcacaaaa       300
     ggcacatagc agaatgtgcc ctaaatgtca gccattgtta tggtattatg taatctacaa       360
     agtatgtttg cttactccgt gtgaaagact ttcagtctat caaacataat acatgtgaaa       420
     tcaaaccttg aaaattaatt tttttcccaa cagtcaagac atttgccagc tgcagagatt       480
     agcatttcat gaatcttagt cttgtctgat ttttttaatg ggaaggaaca actatcctca       540
     actatccttt ttttttttct gtagttttaa aatgaactcc acaaaacatg tttttaatat       600
     agggaattat atgaaattgt ggggtgggca gcgaggttaa aggcagaaat agcccaatgg       660
     tggcacattc actgacacag cctaaaagat tagcaaatta cccagccaac acatacaatt       720
     aatacaatta atatttttat agttaaaaca gagttactaa agaaattgtt tgaaaagaaa       780
     attatgaaga ctggaaagac ggctcagtgc ttaagagctt tggctagtct tccagagaac       840
     cagggtcatc cagcactcac aaggcagctt gtgagctgat actatctgta tattcagtcc       900
     tagggaatct gatgctttgt cctgacctcc aaaacaggca caaatgtggt gcacaggcaa       960
     atgtagagat aagactccca tgcacagaac ataaataacg tagtttaatt ttttaaattg      1020
     taaaactgaa aatggttgca cttgcatttt tattttcagc acatccccag atatccgcca      1080
     tataacaaga aaatgatgcc acactcccaa gaattaagaa ttacacctcc caaccctacc      1140
     caaatgtgta tactctaggt ctaaagaaat gcaaaggatg aagttactgc cttgtgcggt      1200
     tctcaaggag ggaggatgcc aaaaaaatat tttttcacaa agtgtgctga gaaactctgt      1260
     agctgttgga gtcatctcct gtgctcttgc caaataactg aaaggggata cactggatgt      1320
     ctgtgaatgg ggtgtcactt atgagtgcta gaagcgggta cctggatgtg gacacggtgt      1380
     ctgagtggtc cgcactccat gtctccacag gagcgcttat gtgtgtttct ttcctcctgc      1440
     ttctgggtgt tcctgggttt gtttacagcc acctctctgt tggaccagga gacagctgtc      1500
     gtctccagaa tgagcgggca cgggtgtgtc tcggtggctg tggctgtggt tcggcataag      1560
     tctgagcatg tcctggtcgt cagggtgcgt ttgtgctgtg tgtgcgtgtc cgggtgagct      1620
     tgctctttct gttcctaaaa gaaaatgcac cctgcgctac cggcgtccag agactctcag      1680
     cccgcagagg tgacctgaac ggacaggtag cacctccaga cagcgcctgg ttggcgggtt      1740
     gcacagcagc cccagatttc tctctctggt gccccagcta gggtagctgg aagggagcgg      1800
     tggcctggcc tccggggagc cgctgggccc cgccgggcta acccaggagg aggccggcta      1860
     ggctgggagg gttagccctt ggtgccctac gcctgcccgg gccagtcgcg gccgccggcc      1920
     attggcccaa agaattgttg cacgtcactg gcaattcccc tagaagtctg tgcacataac      1980
     gggcagggcg cactgcaagg ctgcttctcc cgcatttagg ctgcggctgc aggcaccgcg      2040
     agcccggagc acccacgagc ttagtgtgca ggacgcaccc cagcacagcc acctacggcc      2100
     gctgaatgaa gcttccagga gtccgccccc ggccgtcgcc ccgtcggagg tgcacccgct      2160
     gagagcgcct ggaccgaaag gccggtgcgc tcacctgcta acctgccagc catggggcca      2220
     cacgggaacg acagcgactt cttgctggca cccaacggaa gccgagcgcc acaccacgac      2280
     gtcactcagg aacgggacga agcgtgggtt gtgggcatgg ccatcctcat gtcggttatc      2340
     gtcctggcca tcgtgtttgg caacgtgctg gtcatcacag ccattgccaa gttcgagcga      2400
     ctacaaaccg tcaccaacta cttcataatc tccttggcgt gtgctgatct agtcatgggc      2460
     ctagcggtgg tgccgtttgg ggccagtcac acctctatga aaatgtggaa ttttggcaac      2520
     ttctggtgcg agttctggac ttccattgat gtgttgtgcg tcacagccag catcgagacc      2580
     ctgtgcgtga ttgcagtgga tcgctatgtt gctatcacat cgcccttcaa gtaccagagc      2640
     ctgctgacca agaataaggc ccgagtggtc atcctgatgg tatggattgt atctggcctt      2700
     acctcctttt tgcctatcca gatgcactgg taccgtgcca cccacaagaa agctatcgat      2760
     tgttacaccg aggagacttg ctgtgacttc ttcacgaacc aggcctacgc catcgcgtcc      2820
     tcgattgtgt ctttctacgt gcccctggtg gtgatggtct ttgtctattc ccgggtcttc      2880
     caggtggcca aaaggcagct gcagaagata gacaaatctg aaggaagatt ccacgcccaa      2940
     aacctcagcc aggtggagca ggatgggcgg acgggccacg gactccgaag gtcctccaag      3000
     ttctgcttga aagagcacaa agccctcaag actttaggca tcatcatggg cacattcacc      3060
     ctctgctggc tgcccttctt cattgtcaat atcgtgcacg ttatcaggga caacctcatc      3120
     cctaaggaag tttacattct ccttaactgg ttgggctacg tcaactctgc cttcaatcct      3180
     cttatctact gtcggagtcc agatttcagg attgcctttc aagagcttct gtgccttcgc      3240
     aggtcttcct tcgaaaccta tgggaacggc tactctagca atagcaacgg cagaacggac      3300
     tacacagggg agccaaacac ttgtcagctg gggcaggaga gagaacagga actgctgtgt      3360
     gaggatcccc caggcatgga aggctttgtg aactgtcaag gtactgtgcc tagccttagc      3420
     gttgactccc aaggaaggaa ctgtagtaca aatgactcgc cactgtaata caggctttct      3480
     actctctaag acccctcctt gacaggacac taaccagact atttaacttg agtgtaataa      3540
     ctttagaata aaattgtata gagatttgca gaaggggggg cacatccttc tcgccttttt      3600
     ttaattttta ttttattttt tagctgcaaa caagagagag aactgtattt gagtgcttat      3660
     tgttcttgta tagttcagtt cctcttgtat ggaacttaaa ggtttctgtc tgaagagtgt      3720
     tggttctgag gactgagtct gtctgtctgt ctgtctgtct gtctgtctgg atgatgtttt      3780
     catgtatcta cctcactggt caagtattaa gaatgatata tattgctgct ggaaatccat      3840
     atctaaagga gagagttttc ttcctgtacc cttggacttg aaatatcctg tgtcttggac      3900
     ctttctgctg tgacaatggg ccctttctct ctcactccac ttatttactc aaatggattc      3960
     gaggcaggga tttgagggac aacactagtt gttttgtttt tgtttttgtt tttttgtttg      4020
     tttggttcgt ttttggtttg ttgttgtttt ttggggtttg tttttgtttt tgtttttttg      4080
     ggtttttttt ttttgctgag aaaagtctaa agtttacagt aaataaattg tttaaccatg      4140
     acttcattgc acccgtttct tcaaaacctc ttgactctgg agtgtccttg tctctcccac      4200
     tggaaaccac aggtaaacta tgtgtcgtga ccgatgagtg gcttaatgtg taagagtacc      4260
     agaatggcat gcttgcatgc accgtgccta gcccttccgt gtgtgtcttc agagctccag      4320
     atgcaaacct gtgccttccc taacttcact cgtgtcccaa agcagtcctg cctgttcaca      4380
     gcataaccca gtatgtccta cagttgctct tctgtgctgt cactccagaa accctgactc      4440
     acggaaacag agttatggac atatgttttt gtccccatat gctctgacac caccttcagc      4500
     cttacttgct taataactgt gtatatttac atcactgcgt ctcttacagt agtgcctttg      4560
     tactgcatca gggcttggtg tgttcaggat gaggaagatg ttctgtgtaa tagctgttca      4620
     agcatctaga aattctgagg gaaatcaaag gcctcggtca gagagagaga gagagagcaa      4680
     agctttaaaa aacatagctg gtgaatgctt cacgcccttc agcctctcct cgctccgtct      4740
     gctgtcccgt gtcttctgtt cccaattctc tgcacttctg tgtaaaccag gcttcccatg      4800
     tctggcattc cgtgcattat atgatatttg gcggcacgtc tgtaccagta aattctggta      4860
     gcacccccta gttacaataa ttgcagacac tcagcgcgta cgacccccta gttacatatg      4920
     cagacact                                                               4928
//