Dbfetch

ID   X15210; SV 1; linear; mRNA; STD; MUS; 228 BP.
XX
AC   X15210;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Murine mRNA fragment for A4 amyloid precursor protein
XX
KW   amyloid A4 protein; amyloid protein; membrane protein; protease inhibitor.
XX
OS   Mus musculus domesticus (western European house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-228
RA   Deeb S.S.;
RT   ;
RL   Submitted (09-MAY-1989) to the INSDC.
RL   Deep S.S., University of Waschington, Department of Medicine , Division of
RL   Medical Genetics, RG 25, University of Waschington , Seattle, WA 98195 USA.
XX
RN   [2]
RP   1-228
RX   DOI; 10.1093/nar/17.13.5396.
RX   PUBMED; 2569710.
RA   Fukuchi K., Martin G.M., Deeb S.S.;
RT   "Sequence of the protease inhibitor domain of the A4 amyloid protein
RT   precursor of Mus domesticus";
RL   Nucleic Acids Res. 17(13):5396-5396(1989).
XX
DR   MD5; c0b98f483cbd860d1dde73f660b495d8.
DR   EuropePMC; PMC318135; 2569710.
XX
CC   Data kindly reviewed (27-OCT-1989) by Fukuchi K.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Mus musculus domesticus"
FT                   /chromosome="chromosome 16."
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt10."
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:10092"
FT   CDS             <1..>228
FT                   /codon_start=1
FT                   /product="amyloid A4 preprotein (76 AA)"
FT                   /db_xref="GOA:P12023"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR008154"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR011178"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR015849"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019744"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR020901"
FT                   /db_xref="InterPro:IPR024329"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="PDB:2ROZ"
FT                   /db_xref="PDB:2YSZ"
FT                   /db_xref="PDB:2YT0"
FT                   /db_xref="PDB:2YT1"
FT                   /db_xref="PDB:4YN0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12023"
FT                   /protein_id="CAA33280.1"
FT                   /translation="EVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDT
FT                   EEYCMAVCGSVSTQSLLKTTSEPLPQDPDKL"
FT   misc_feature    4..160
FT                   /note="protease inhibitor domain"
FT   misc_feature    complement(125..161)
FT                   /note="MRC OX-2 antigen homologous domain"
XX
SQ   Sequence 228 BP; 56 A; 58 C; 62 G; 52 T; 0 other;
     gaggtgtgct ctgaacaagc cgagaccggg ccatgccgcg caatgatctc ccgctggtac        60
     tttgatgtca ctgaagggaa gtgtgtccca ttcttttacg gcggatgtgg cggcaacagg       120
     aacaactttg acacggaaga gtactgcatg gcggtgtgtg gcagcgtgtc aacccaaagt       180
     ttactcaaga ctaccagtga acctcttccc caagatcctg ataaactt                    228
//