spacer

EBI Dbfetch

ID   X13060; SV 1; linear; genomic DNA; STD; MUS; 2100 BP.
XX
AC   X13060;
XX
DT   13-FEB-1991 (Rel. 27, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 13)
XX
DE   Mouse serum albumin gene with LINE-1 repeat.
XX
KW   LINE repetitive sequence; repetitive sequence; serum albumin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2100
RA   Meunier-Rotival M.;
RT   ;
RL   Submitted (26-SEP-1988) to the INSDC.
RL   Meunier-Rotival M., CNRS, INSERM U56, Hopital de Bicetre, 78 Rue du General
RL   Leclerc, F094275 Kremlin Bicetre, France.
XX
RN   [2]
RP   1-2100
RX   DOI; 10.1016/0378-1119(90)90030-U.
RX   PUBMED; 1971802.
RA   Boccaccio C., Deschatrette J., Meunier-Rotival M.;
RT   "Empty and occupied insertion site of the truncated LINE-1 repeat located
RT   in the mouse serum albumin-encoding gene";
RL   Gene 88(2):181-186(1990).
XX
DR   MD5; afab420689a076c5231689621c02d696.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2100
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="BALB/c"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Charon 4A"
FT                   /clone="lambda a/b6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..228
FT                   /codon_start=1
FT                   /product="serum albumin"
FT                   /db_xref="GOA:P07724"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07724"
FT                   /protein_id="CAA31458.1"
FT                   /translation="LSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTVDETY
FT                   VPKEFKAETFTFHSDICTLPEKEKQIKKQT"
XX
SQ   Sequence 2100 BP; 676 A; 416 C; 471 G; 537 T; 0 other;
     ctgtctgcaa tcctgaaccg tgtgtgtctg ctgcatgaga agaccccagt gagtgagcat        60
     gttaccaagt gctgtagtgg atccctggtg gaaaggcggc catgcttctc tgctctgaca       120
     gttgatgaaa catatgtccc caaagagttt aaagctgaga ccttcacctt ccactctgat       180
     atctgcacac ttccagagaa ggagaagcag attaagaaac aaacgtgagc aatatttttt       240
     attgcatcta ttttcatact gcatatgtat tgatagtgag aactgacaac tggacatttt       300
     tttgttttga tgcagtgatt atatattcct tagagagaag tgtttagatg ttggcatcac       360
     tgagttgaaa gagtgtcaaa attttttgtc tctgtgaaaa aattttctat taaaatcttt       420
     cattcaactt atctttatta ctgtgggcta aaaccacagt agaataaaat tctagtggag       480
     gcccaataga agacactaaa taccagttag tggatataga tagaagaact ggtcatggaa       540
     atcatacaag tatttattgc aaggtaggaa tagttgattg aaaatgttcc acgtacatct       600
     acacaatgga gtactactca gctattaaaa agaatgaatt tatgaaattc ctagccaaat       660
     ggatggacct ggagggcatc atcctgagtg aggtaacaca ttcacaaaga aactcacaca       720
     atatgtattc actgataagt ggatattagc cccaaaccta ggatacccaa gatataagat       780
     ataatttgct aaacacatga aactcaagga gaatgaagac tgaagtgtgg acactatgcc       840
     cctccttaga tttgggaaca aaacacccat ggaaggagtt acagagacgg agtttggagc       900
     tgagatgaaa ggatggacca tgtagagact gccatagcca gggatccacc ccataatcag       960
     catccaaacg ctgacaccat tgcatacact agcaagattt tattgaaagg acgcagatgt      1020
     agctgtctct tgtgagacta tgccggggcc cagcaaacac agaagtggat gctcacagtc      1080
     agctaatgga tggatcatag ggctcccaat ggaggagcta gagaaagtag ccaaggagct      1140
     aaagggacct gcaaccctat aggtggaaca acattatgag ctaaccagta cccggagctc      1200
     ttgactctag ctgcatatat atcaaaagat ggcctagtcg gccatcactg gaaagagagg      1260
     cccattggac ttgcaaactt tatatgcccc agtacagggg aataccaggg ccaaaaaggg      1320
     ggagtgggtg ggcaggggag tgggggtggg tggatatggg ggacttttgg tatagcattg      1380
     gaaatgtaaa tgagttaaat acctaataaa aaatggaaaa aaaaaaaaaa aaaaaaaaaa      1440
     aaaaaaaaaa aaaagaaaat gttccacgaa gaagccatgc aggggcaagg caacgtcatg      1500
     ggtgtgactt ttgagaatgg agtaagaaac agctggaagt gtacatagga ggttcgaacc      1560
     ctgctgaagg gagaggttcc aatactacaa aatgtagcgg gatattgtca tcacctttgg      1620
     ggacatgtca tcatggtccc cagacagagt tacaaaactc atcccctaca cagcactatg      1680
     tctctggtac tgtttgttct acagatgtca acaacagagg cccagccatc tcctattgct      1740
     tggcttgtca gtctttctag cctcccatta ttaatttcaa atggggcagg tgttaggagg      1800
     gcaaaaatcc acatattaag tgcaaagcct ttcaaggaga tttcctgaaa ctagacaaaa      1860
     cccgtgtgac tggcatcgat tattctattt gatctagcta gtcctagcaa agtgacaact      1920
     gctactcccc tcctacacag ccaagattcc taagttggca gtggcatgct taatcctcaa      1980
     agccaaagtt acttggctcc aagatttata gccttaaact gtggcctcac attccttcct      2040
     atcttacaaa cactgcactg gggtaaatgt ctccttgctc ttcttgcttt cttccttctg      2100
//


spacer
spacer