spacer

EBI Dbfetch

ID   X06024; SV 1; linear; genomic DNA; STD; MUS; 1023 BP.
XX
AC   X06024;
XX
DT   29-NOV-1987 (Rel. 14, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Mouse Hox-1.6 mRNA fragment
XX
KW   homeobox; HOX-1.6 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1023
RX   PUBMED; 2891503.
RA   Baron A.J., Featherstone M.S., Hill R.E., Hall A., Galliot B., Duboule D.;
RT   "Hox-1.6: a mouse homeo-box-containing gene member of the Hox-1 complex";
RL   EMBO J. 6(10):2977-2986(1987).
XX
DR   MD5; 26b7102e37d89e41723d0fd326887b13.
DR   Ensembl-Gn; ENSMUSG00000029844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000964; mus_musculus.
XX
CC   Data kindly reviewed (8.1.88) by Doboule
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1023
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <544..>723
FT                   /note="homeobox"
FT                   /db_xref="GOA:P09022"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /protein_id="CAA29427.1"
FT                   /translation="PNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQV
FT                   KIWFQNRRMKQKKRE"
XX
SQ   Sequence 1023 BP; 248 A; 324 C; 239 G; 212 T; 0 other;
     gaagtgagaa agttggcacg gtcacccatg cttcgcagga tccaatcact cagtgacaga        60
     tggacaatgc aagaatgaac tcctttctgg aataccccat ccttggcagt ggcgactctg       120
     ggacctgctc ggcgcgagct tacccctctg accatgggat tacaactttc caatcctgcg       180
     cggtcagtgc caacagctgc ggcggcgacg accgcttcct agtgggcagg ggggtgcaga       240
     tcagctcgcc ccaccaccac caccaccacc accaccatca ccacccccag acggctactt       300
     accagacttc tggaaacctt gggatttctt attcccactc gagttgtggt ccaagctatg       360
     gcgcgcagaa cttcagtgcg ccttatggcc cctatggatt aaatcaggaa gcagacccac       420
     caagaagcct gtcgttcccc tgcttcagag acgtcttctc cagcgcagac ctttgactgg       480
     atgaaagtta aaagaaaccc tcccaaaaca gggaaagttg gagagtacgg ctacgtgggt       540
     caacccaacg cagtgcgcac caatttcacc accaagcagc tcacagagct ggagaaggag       600
     ttccacttca acaagtacct tacacgagcg cgcagggtgg agattgccgc gtccctacag       660
     ctcaatgaga cccaggtgaa gatctggttc cagaatcgcc gcatgaagca gaagaagcgt       720
     gagaaggagg ggctcctgcc catctcccct gccactcctc ctggcagcga tgagaaaacg       780
     gaagaatcat ctgagaaatc tagcccctcg cccagtgccc cttctccggc atcgtctacc       840
     tcagacactc tgactacctc ccactgaggc tactccagcc caactctgca gcccaggctt       900
     ctccctgggc tgggatttct tacccaaagc acattcttag cttatctcct ttctttacag       960
     atctctcttc ctttctcgtc ccatctgggg agctcctggc caagataagg tatttccaga      1020
     gaa                                                                    1023
//


spacer
spacer