spacer

EBI Dbfetch

ID   X06023; SV 1; linear; genomic DNA; STD; MUS; 300 BP.
XX
AC   X06023;
XX
DT   29-NOV-1987 (Rel. 14, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Mouse Hox-1.6 homeo-box-containing gene
XX
KW   homeobox; HOX-1.6 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-300
RX   PUBMED; 2891503.
RA   Baron A.J., Featherstone M.S., Hill R.E., Hall A., Galliot B., Duboule D.;
RT   "Hox-1.6: a mouse homeo-box-containing gene member of the Hox-1 complex";
RL   EMBO J. 6(10):2977-2986(1987).
XX
DR   MD5; 3e0b42fa91fc0ee62a04e5db80bcc453.
DR   Ensembl-Gn; ENSMUSG00000029844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000964; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..300
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <61..>240
FT                   /note="homeo-box"
FT                   /db_xref="GOA:P09022"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09022"
FT                   /protein_id="CAA29426.1"
FT                   /translation="PNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQV
FT                   KIWFQNRRMKQKKRE"
XX
SQ   Sequence 300 BP; 77 A; 90 C; 78 G; 55 T; 0 other;
     tcttttctct cttcctcccc taccctaggg aaagttggag agtacggcta cgtgggtcaa        60
     cccaacgcag tgcgcaccaa tttcaccacc aagcagctca cagagctgga gaaggagttc       120
     cacttcaaca agtaccttac acgagcgcgc agggtggaga ttgccgcgtc cctacagctc       180
     aatgagaccc aggtgaagat ctggttccag aatcgccgca tgaagcagaa gaagcgtgag       240
     aaggaggggc tcctgcccat ctcccctgcc actcctcctg gcagcgatga gaaaacggaa       300
//


spacer
spacer