Dbfetch

ID   X05908; SV 1; linear; mRNA; STD; HUM; 1399 BP.
XX
AC   X05908;
XX
DT   29-NOV-1987 (Rel. 14, Created)
DT   26-NOV-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for lipocortin
XX
KW   lipocortin; phospholipase a2 inhibitor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1399
RX   DOI; 10.1038/320077a0.
RX   PUBMED; 2936963.
RA   Wallner B.P., Mattaliano R.J., Hession C., Cate R.L., Tizard R.,
RA   Sinclair L.K., Foeller C., Chow E.P., Browning J.L., Ramachandran K.L.,
RA   Pepinsky R.B.;
RT   "Cloning and expression of human lipocortin, a phospholipase A2 inhibitor
RT   with potential anti-inflammatory activity";
RL   Nature 320(6057):77-81(1986).
XX
DR   MD5; 8fe1acc27e3d6f3f91e4d26dec54bd9b.
DR   Ensembl-Gn; ENSG00000135046; homo_sapiens.
DR   Ensembl-Tr; ENST00000257497; homo_sapiens.
DR   Ensembl-Tr; ENST00000376911; homo_sapiens.
DR   EuropePMC; PMC24397; 9826724.
DR   EuropePMC; PMC310902; 10984457.
DR   EuropePMC; PMC310944; 11076866.
DR   EuropePMC; PMC434115; 15220421.
DR   EuropePMC; PMC87031; 11340171.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1399
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   precursor_RNA   24..1399
FT                   /note="primary transcript"
FT   CDS             75..1115
FT                   /note="lipocortin (AA 1-346)"
FT                   /db_xref="GOA:P04083"
FT                   /db_xref="H-InvDB:HIT000486570.6"
FT                   /db_xref="HGNC:HGNC:533"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002388"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="PDB:1AIN"
FT                   /db_xref="PDB:1BO9"
FT                   /db_xref="PDB:1QLS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04083"
FT                   /protein_id="CAA29338.1"
FT                   /translation="MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPS
FT                   SDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHL
FT                   EEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRD
FT                   LAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFN
FT                   TILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEK
FT                   LHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILV
FT                   ALCGGN"
FT   misc_feature    1379..1384
FT                   /note="pot. polyA signal"
XX
SQ   Sequence 1399 BP; 464 A; 273 C; 298 G; 364 T; 0 other;
     agtgtgaaat cttcagagaa gaatttctct ttagttcttt gcaagaaggt agagataaag        60
     acactttttc aaaaatggca atggtatcag aattcctcaa gcaggcctgg tttattgaaa       120
     atgaagagca ggaatatgtt caaactgtga agtcatccaa aggtggtccc ggatcagcgg       180
     tgagccccta tcctaccttc aatccatcct cggatgtcgc tgccttgcat aaggccataa       240
     tggttaaagg tgtggatgaa gcaaccatca ttgacattct aactaagcga aacaatgcac       300
     agcgtcaaca gatcaaagca gcatatctcc aggaaacagg aaagcccctg gatgaaacac       360
     ttaagaaagc ccttacaggt caccttgagg aggttgtttt agctctgcta aaaactccag       420
     cgcaatttga tgctgatgaa cttcgtgctg ccatgaaggg ccttggaact gatgaagata       480
     ctctaattga gattttggca tcaagaacta acaaagaaat cagagacatt aacagggtct       540
     acagagagga actgaagaga gatctggcca aagacataac ctcagacaca tctggagatt       600
     ttcggaacgc tttgctttct cttgctaagg gtgaccgatc tgaggacttt ggtgtgaatg       660
     aagacttggc tgattcagat gccagggcct tgtatgaagc aggagaaagg agaaagggga       720
     cagacgtaaa cgtgttcaat accatcctta ccaccagaag ctatccacaa cttcgcagag       780
     tgtttcagaa atacaccaag tacagtaagc atgacatgaa caaagttctg gacctggagt       840
     tgaaaggtga cattgagaaa tgcctcacag ctatcgtgaa gtgcgccaca agcaaaccag       900
     ctttctttgc agagaagctt catcaagcca tgaaaggtgt tggaactcgc cataaggcat       960
     tgatcaggat tatggtttcc cgttctgaaa ttgacatgaa tgatatcaaa gcattctatc      1020
     agaagatgta tggtatctcc ctttgccaag ccatcctgga tgaaaccaaa ggagattatg      1080
     agaaaatcct ggtggctctt tgtggaggaa actaaacatt cccttgatgg tctcaagcta      1140
     tgatcagaag actttaatta tatattttca tcctataagc ttaaatagga aagtttcttc      1200
     aacaggatta cagtgtagct acctacatgc tgaaaaatat agcctttaaa tcatttttat      1260
     attataactc tgtataatag agataagtcc attttttaaa aatgttttcc ccaaaccata      1320
     aaaccctata caagttgttc tagtaacaat acatgagaaa gatgtctatg tagctgaaaa      1380
     taaaatgacg tcacaagac                                                   1399
//