spacer

EBI Dbfetch

ID   X04741; SV 1; linear; mRNA; STD; HUM; 1014 BP.
XX
AC   X04741;
XX
DT   19-SEP-1987 (Rel. 13, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Human mRNA for protein gene product (PGP) 9.5
XX
KW   neuroendocrine marker protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1014
RX   DOI; 10.1016/0014-5793(87)81327-3.
RX   PUBMED; 2947814.
RA   Day I.N.M., Thompson R.J.;
RT   "Molecular cloning of cDNA coding for human PGP 9.5 protein";
RL   FEBS Lett. 210(2):157-160(1987).
XX
DR   MD5; a88e8511dc2367ce70186e8dfc99ee18.
DR   Ensembl-Gn; ENSG00000154277; homo_sapiens.
DR   Ensembl-Tr; ENST00000284440; homo_sapiens.
DR   Ensembl-Tr; ENST00000503431; homo_sapiens.
DR   EuropePMC; PMC111932; 10756030.
DR   EuropePMC; PMC186614; 12097349.
XX
CC   Data kindly reviewed (09-JUL-1987) by Day I.N.M.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1014
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   misc_feature    27..34
FT                   /note="translation initiation consensus sequence"
FT   CDS             32..670
FT                   /note="PGP 9.5 (AA 1-212)"
FT                   /db_xref="GOA:P09936"
FT                   /db_xref="H-InvDB:HIT000321064.14"
FT                   /db_xref="HGNC:HGNC:12513"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="PDB:2ETL"
FT                   /db_xref="PDB:2LEN"
FT                   /db_xref="PDB:3IFW"
FT                   /db_xref="PDB:3IRT"
FT                   /db_xref="PDB:3KVF"
FT                   /db_xref="PDB:3KW5"
FT                   /db_xref="PDB:4DM9"
FT                   /db_xref="PDB:4JKJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09936"
FT                   /protein_id="CAA28443.1"
FT                   /translation="MLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLT
FT                   AQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLK
FT                   QFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYE
FT                   LDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA"
FT   misc_feature    993..998
FT                   /note="polyadenylation signal"
FT   polyA_site      1014..1014
FT                   /note="polyA site"
XX
SQ   Sequence 1014 BP; 256 A; 242 C; 267 G; 249 T; 0 other;
     gcagaaatag cctagggaga tcaaccccga gatgctgaac aaagtgctgt cccggctggg        60
     ggtcgccggc cagtggcgct tcgtggacgt gctggggctg gaagaggagt ctctgggctc       120
     ggtgccagcg cctgcctgcg cgctgctgct gctgtttccc ctcacggccc agcatgagaa       180
     cttcaggaaa aagcagattg aagagctgaa gggacaagaa gttagtccta aagtgtactt       240
     catgaagcag accattggga attcctgtgg cacaatcgga cttattcacg cagtggccaa       300
     taatcaagac aaactgggat ttgaggatgg atcagttctg aaacagtttc tttctgaaac       360
     agagaaaatg tcccctgaag acagagcaaa atgctttgaa aagaatgagg ccatacaggc       420
     agcccatgat gccgtggcac aggaaggcca atgtcgggta gatgacaagg tgaatttcca       480
     ttttattctg tttaacaacg tggatggcca cctctatgaa cttgatggac gaatgccttt       540
     tccggtgaac catggcgcca gttcagagga caccctgctg aaggacgctg ccaaggtgtg       600
     cagagaattc accgagcgtg agcaaggaga agtccgcttc tctgccgtgg ctctctgcaa       660
     ggcagcctaa tgctctgtgg gagggacttt gctgatttcc cctcttccct tcaacatgaa       720
     aatatatacc ccccatgcag tctaaaatgc ttcagtactt gtgaaacaca gctgttcttc       780
     tgttctgcag acacgccttc ccctcagcca cacccaggca cttaagcaca agcagagtgc       840
     acagctgtcc actgggccat tgtggtgtga gcttcagatg gtgaagcatt ctccccagtg       900
     tatgtcttgt atccgatatc taacgcttta aatggctact ttggtttctg tctgtaagtt       960
     aagaccttgg atgtggttat gttgtcctaa agaataaatt ttgctgatag tagc            1014
//


spacer
spacer