Dbfetch

ID   X04054; SV 1; linear; genomic DNA; STD; HUM; 268 BP.
XX
AC   X04054;
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human  HLA-DRB1*03.01 gene for class II antigen beta I  (DR3)
XX
KW   antigen; class II antigen; histocompatibility antigen;
KW   major histocompatibility complex; surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-268
RX   DOI; 10.1038/322067a0.
RX   PUBMED; 3459965.
RA   Gorski J., Mach B.;
RT   "Polymorphism of human Ia antigens: gene conversion between two DR beta
RT   loci results in a new HLA-D/DR specificity";
RL   Nature 322(6074):67-70(1986).
XX
DR   MD5; d86717ea6219692a54064ad8f837c10a.
XX
CC   Data kindly reviewed () by Mach B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..268
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DR3"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>268
FT                   /codon_start=3
FT                   /note="DR antigen beta I first domain (1 is 2nd base in
FT                   codon) (268 is 2nd base in codon)"
FT                   /db_xref="GOA:O19660"
FT                   /db_xref="IMGT/HLA:DRB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19660"
FT                   /protein_id="CAA27687.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 268 BP; 58 A; 64 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcg                                          268
//