Dbfetch

ID   X02910; SV 1; linear; genomic DNA; STD; HUM; 3634 BP.
XX
AC   X02910; X02159;
XX
DT   28-JAN-1986 (Rel. 08, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Human gene for tumor necrosis factor (TNF-alpha)
XX
KW   signal peptide; tumor necrosis factor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3634
RX   DOI; 10.1093/nar/13.17.6361.
RX   PUBMED; 2995927.
RA   Nedwin G.E., Naylor S.L., Sakaguchi A.Y., Smith D., Jarrett-Nedwin J.,
RA   Pennica D., Goeddel D.V., Gray P.W.;
RT   "Human lymphotoxin and tumor necrosis factor genes: structure, homology and
RT   chromosomal localization";
RL   Nucleic Acids Res. 13(17):6361-6373(1985).
XX
RN   [2]
RP   329-3634
RX   DOI; 10.1038/313803a0.
RX   PUBMED; 3883195.
RA   Shirai T., Yamaguchi H., Ito H., Todd C.W., Wallace R.B.;
RT   "Cloning and expression in Escherichia coli of the gene for human tumour
RT   necrosis factor";
RL   Nature 313(6005):803-806(1985).
XX
RN   [3]
RX   DOI; 10.1038/312724a0.
RX   PUBMED; 6392892.
RA   Pennica D., Nedwin G.E., Hayflick J.S., Seeburg P.H., Derynck R.,
RA   Palladino M.A., Kohr W.J., Aggarwal B.B., Goeddel D.V.;
RT   "Human tumour necrosis factor: precursor structure, expression and homology
RT   to lymphotoxin";
RL   Nature 312(5996):724-729(1984).
XX
DR   MD5; 0b9884a204c0a6c822b238b4e23b50d4.
DR   EPD; EP11158; HS_TNF.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   EuropePMC; PMC123149; 12089333.
DR   EuropePMC; PMC1262712; 16191192.
DR   EuropePMC; PMC1312313; 16269079.
DR   EuropePMC; PMC136266; 12050395.
DR   EuropePMC; PMC164766; 12724409.
DR   EuropePMC; PMC16559; 10840051.
DR   EuropePMC; PMC167209; 12885910.
DR   EuropePMC; PMC1852663; 17450233.
DR   EuropePMC; PMC26493; 10677516.
DR   EuropePMC; PMC4622956; 26018625.
DR   EuropePMC; PMC517414; 15322016.
XX
CC   In the cDNA sequence from ref [3] the mature protein site starts
CC   also with Val at pos 1631
CC   Data kindly reviewed (18-FEB-1986) by A. Sakaguchi
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3634
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   regulatory      590..595
FT                   /regulatory_class="TATA_box"
FT   prim_transcript 615..3381
FT                   /note="put. primary transcript"
FT   exon            615..981
FT                   /number=1
FT   misc_difference 768
FT                   /replace="c"
FT                   /note="conflict"
FT                   /citation=[3]
FT   CDS             join(796..981,1589..1634,1822..1869,2171..2592)
FT                   /product="TNF-alpha"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:4TWT"
FT                   /db_xref="PDB:4Y6O"
FT                   /db_xref="PDB:5MU8"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="CAA26669.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   sig_peptide     join(796..981,1589..1630)
FT                   /note="put. signal peptide (aa -76 to -1; aa -78  to -3 in
FT                   ref.[2])"
FT   intron          982..1588
FT                   /number=1
FT   misc_difference 1092
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[2]
FT                   /citation=[3]
FT   exon            1589..1634
FT                   /number=2
FT   mat_peptide     join(1631..1634,1822..1869,2171..2589)
FT                   /product="TNF-alpha"
FT   intron          1635..1821
FT                   /number=2
FT   exon            1822..1869
FT                   /number=3
FT   misc_feature    1822..1823
FT                   /note="put. signal peptide (aa -1, ref. [2])"
FT   misc_feature    1824..1869
FT                   /note="TNF-alpha (aa 1-15, ref. 2)"
FT   intron          1870..2170
FT                   /number=3
FT   exon            2171..3381
FT                   /number=4
FT   misc_feature    2171..2589
FT                   /note="TNF-alpha (aa 18-157; aa 16-155 in ref.  [2])"
FT   misc_difference 2791
FT                   /replace="t"
FT                   /note="conflict"
FT                   /citation=[3]
FT   misc_difference 2882
FT                   /replace="a"
FT                   /note="conflict"
FT                   /citation=[2]
FT   misc_difference 3326
FT                   /replace="a"
FT                   /note="conflict"
FT                   /citation=[2]
FT   regulatory      3368..3373
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3381
XX
SQ   Sequence 3634 BP; 906 A; 959 C; 975 G; 794 T; 0 other;
     gaattccggg tgatttcact cccggctgtc caggcttgtc ctgctacccc acccagcctt        60
     tcctgaggcc tcaagcctgc caccaagccc ccagctcctt ctccccgcag gacccaaaca       120
     caggcctcag gactcaacac agcttttccc tccaacccgt tttctctccc tcaacggact       180
     cagctttctg aagcccctcc cagttctagt tctatctttt tcctgcatcc tgtctggaag       240
     ttagaaggaa acagaccaca gacctggtcc ccaaaagaaa tggaggcaat aggttttgag       300
     gggcatgggg acggggttca gcctccaggg tcctacacac aaatcagtca gtggcccaga       360
     agacccccct cggaatcgga gcagggagga tggggagtgt gaggggtatc cttgatgctt       420
     gtgtgtcccc aactttccaa atccccgccc ccgcgatgga gaagaaaccg agacagaagg       480
     tgcagggccc actaccgctt cctccagatg agctcatggg tttctccacc aaggaagttt       540
     tccgctggtt gaatgattct ttccccgccc tcctctcgcc ccagggacat ataaaggcag       600
     ttgttggcac acccagccag cagacgctcc ctcagcaagg acagcagagg accagctaag       660
     agggagagaa gcaactacag accccccctg aaaacaaccc tcagacgcca catcccctga       720
     caagctgcca ggcaggttct cttcctctca catactgacc cacggcttca ccctctctcc       780
     cctggaaagg acaccatgag cactgaaagc atgatccggg acgtggagct ggccgaggag       840
     gcgctcccca agaagacagg ggggccccag ggctccaggc ggtgcttgtt cctcagcctc       900
     ttctccttcc tgatcgtggc aggcgccacc acgctcttct gcctgctgca ctttggagtg       960
     atcggccccc agagggaaga ggtgagtgcc tggccagcct tcatccactc tcccacccaa      1020
     ggggaaatga gagacgcaag agagggagag agatgggatg ggtgaaagat gtgcgctgat      1080
     agggagggat gagagagaaa aaaacatgga gaaagacggg gatgcagaaa gagatgtggc      1140
     aagagatggg gaagagagag agagaaagat ggagagacag gatgtctggc acatggaagg      1200
     tgctcactaa gtgtgtatgg agtgaatgaa tgaatgaatg aatgaacaag cagatatata      1260
     aataagatat ggagacagat gtggggtgtg agaagagaga tgggggaaga aacaagtgat      1320
     atgaataaag atggtgagac agaaagagcg ggaaatatga cagctaagga gagagatggg      1380
     ggagataagg agagaagaag atagggtgtc tggcacacag aagacactca gggaaagagc      1440
     tgttgaatgc tggaaggtga atacacagat gaatggagag agaaaaccag acacctcagg      1500
     gctaagagcg caggccagac aggcagccag ctgttcctcc tttaagggtg actccctcga      1560
     tgttaaccat tctccttctc cccaacagtt ccccagggac ctctctctaa tcagccctct      1620
     ggcccaggca gtcagtaagt gtctccaaac ctctttccta attctgggtt tgggtttggg      1680
     ggtagggtta gtaccggtat ggaagcagtg ggggaaattt aaagttttgg tcttggggga      1740
     ggatggatgg aggtgaaagt aggggggtat tttctaggaa gtttaagggt ctcagctttt      1800
     tcttttctct ctcctcttca ggatcatctt ctcgaacccc gagtgacaag cctgtagccc      1860
     atgttgtagg taagagctct gaggatgtgt cttggaactt ggagggctag gatttgggga      1920
     ttgaagcccg gctgatggta ggcagaactt ggagacaatg tgagaaggac tcgctgagct      1980
     caagggaagg gtggaggaac agcacaggcc ttagtgggat actcagaacg tcatggccag      2040
     gtgggatgtg ggatgacaga cagagaggac aggaaccgga tgtggggtgg gcagagctcg      2100
     agggccagga tgtggagagt gaaccgacat ggccacactg actctcctct ccctctctcc      2160
     ctccctccag caaaccctca agctgagggg cagctccagt ggctgaaccg ccgggccaat      2220
     gccctcctgg ccaatggcgt ggagctgaga gataaccagc tggtggtgcc atcagagggc      2280
     ctgtacctca tctactccca ggtcctcttc aagggccaag gctgcccctc cacccatgtg      2340
     ctcctcaccc acaccatcag ccgcatcgcc gtctcctacc agaccaaggt caacctcctc      2400
     tctgccatca agagcccctg ccagagggag accccagagg gggctgaggc caagccctgg      2460
     tatgagccca tctatctggg aggggtcttc cagctggaga agggtgaccg actcagcgct      2520
     gagatcaatc ggcccgacta tctcgacttt gccgagtctg ggcaggtcta ctttgggatc      2580
     attgccctgt gaggaggacg aacatccaac cttcccaaac gcctcccctg ccccaatccc      2640
     tttattaccc cctccttcag acaccctcaa cctcttctgg ctcaaaaaga gaattggggg      2700
     cttagggtcg gaacccaagc ttagaacttt aagcaacaag accaccactt cgaaacctgg      2760
     gattcaggaa tgtgtggcct gcacagtgaa gtgctggcaa ccactaagaa ttcaaactgg      2820
     ggcctccaga actcactggg gcctacagct ttgatccctg acatctggaa tctggagacc      2880
     agggagcctt tggttctggc cagaatgctg caggacttga gaagacctca cctagaaatt      2940
     gacacaagtg gaccttaggc cttcctctct ccagatgttt ccagacttcc ttgagacacg      3000
     gagcccagcc ctccccatgg agccagctcc ctctatttat gtttgcactt gtgattattt      3060
     attatttatt tattatttat ttatttacag atgaatgtat ttatttggga gaccggggta      3120
     tcctggggga cccaatgtag gagctgcctt ggctcagaca tgttttccgt gaaaacggag      3180
     ctgaacaata ggctgttccc atgtagcccc ctggcctctg tgccttcttt tgattatgtt      3240
     ttttaaaata tttatctgat taagttgtct aaacaatgct gatttggtga ccaactgtca      3300
     ctcattgctg agcctctgct ccccagggga gttgtgtctg taatcgccct actattcagt      3360
     ggcgagaaat aaagtttgct tagaaaagaa acatggtctc cttcttggaa ttaattctgc      3420
     atctgcctct tcttgtgggt gggaagaagc tccctaagtc ctctctccac aggctttaag      3480
     atccctcgga cccagtccca tccttagact cctagggccc tggagaccct acataaacaa      3540
     agcccaacag aatattcccc atcccccagg aaacaagagc ctgaacctaa ttacctctcc      3600
     ctcagggcat gggaatttcc aactctggga attc                                  3634
//