Dbfetch

ID   X01394; SV 1; linear; mRNA; STD; HUM; 1643 BP.
XX
AC   X01394;
XX
DT   13-JUN-1985 (Rel. 06, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Human mRNA for tumor necrosis factor
XX
KW   tumor necrosis factor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1643
RX   DOI; 10.1038/312724a0.
RX   PUBMED; 6392892.
RA   Pennica D., Nedwin G.E., Hayflick J.S., Seeburg P.H., Derynck R.,
RA   Palladino M.A., Kohr W.J., Aggarwal B.B., Goeddel D.V.;
RT   "Human tumour necrosis factor: precursor structure, expression and homology
RT   to lymphotoxin";
RL   Nature 312(5996):724-729(1984).
XX
RN   [2]
RX   DOI; 10.1038/313803a0.
RX   PUBMED; 3883195.
RA   Shirai T., Yamaguchi H., Ito H., Todd C.W., Wallace R.B.;
RT   "Cloning and expression in Escherichia coli of the gene for human tumour
RT   necrosis factor";
RL   Nature 313(6005):803-806(1985).
XX
DR   MD5; 93e67df5105f96e8e13ffbb33dae3587.
DR   CABRI; LMBP 1408.
DR   CABRI; LMBP 1627.
DR   CABRI; LMBP 1795.
DR   CABRI; LMBP 2345.
DR   CABRI; LMBP 2346.
DR   CABRI; LMBP 2411.
DR   CABRI; LMBP 2529.
DR   CABRI; LMBP 2530.
DR   CABRI; LMBP 2531.
DR   CABRI; LMBP 2532.
DR   CABRI; LMBP 2533.
DR   CABRI; LMBP 2534.
DR   CABRI; LMBP 2541.
DR   CABRI; LMBP 2571.
DR   CABRI; LMBP 2602.
DR   CABRI; LMBP 2604.
DR   CABRI; LMBP 2605.
DR   CABRI; LMBP 2606.
DR   CABRI; LMBP 2607.
DR   CABRI; LMBP 2609.
DR   CABRI; LMBP 2610.
DR   CABRI; LMBP 2611.
DR   CABRI; LMBP 2612.
DR   CABRI; LMBP 2614.
DR   CABRI; LMBP 2615.
DR   CABRI; LMBP 2617.
DR   CABRI; LMBP 2618.
DR   CABRI; LMBP 2619.
DR   CABRI; LMBP 2620.
DR   CABRI; LMBP 2621.
DR   CABRI; LMBP 2622.
DR   CABRI; LMBP 2624.
DR   CABRI; LMBP 2626.
DR   CABRI; LMBP 2628.
DR   CABRI; LMBP 2629.
DR   CABRI; LMBP 2630.
DR   CABRI; LMBP 2631.
DR   CABRI; LMBP 2632.
DR   CABRI; LMBP 2633.
DR   CABRI; LMBP 2634.
DR   CABRI; LMBP 2636.
DR   CABRI; LMBP 2637.
DR   CABRI; LMBP 2638.
DR   CABRI; LMBP 2639.
DR   CABRI; LMBP 2640.
DR   CABRI; LMBP 2642.
DR   CABRI; LMBP 2644.
DR   CABRI; LMBP 2646.
DR   CABRI; LMBP 2650.
DR   CABRI; LMBP 2651.
DR   CABRI; LMBP 2652.
DR   CABRI; LMBP 2653.
DR   CABRI; LMBP 2654.
DR   CABRI; LMBP 2700.
DR   CABRI; LMBP 2701.
DR   CABRI; LMBP 2702.
DR   CABRI; LMBP 2703.
DR   CABRI; LMBP 2704.
DR   CABRI; LMBP 2705.
DR   CABRI; LMBP 2706.
DR   CABRI; LMBP 2707.
DR   CABRI; LMBP 2708.
DR   CABRI; LMBP 2709.
DR   CABRI; LMBP 2710.
DR   CABRI; LMBP 2711.
DR   CABRI; LMBP 2712.
DR   CABRI; LMBP 2713.
DR   CABRI; LMBP 2714.
DR   CABRI; LMBP 2715.
DR   CABRI; LMBP 3796.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   EuropePMC; PMC1061522; 15767448.
DR   EuropePMC; PMC1069527; 15795279.
DR   EuropePMC; PMC108174; 9573100.
DR   EuropePMC; PMC112151; 10864655.
DR   EuropePMC; PMC1189685; 11768130.
DR   EuropePMC; PMC129347; 12195015.
DR   EuropePMC; PMC1383059; 8675083.
DR   EuropePMC; PMC147622; 9592171.
DR   EuropePMC; PMC2173611; 14662751.
DR   EuropePMC; PMC2394363; 12888831.
DR   EuropePMC; PMC538957; 15618178.
DR   H-InvDB; HIT000320894_05.4.
DR   H-InvDB; HIT000320894_06.4.
DR   H-InvDB; HIT000320894_07.4.
DR   H-InvDB; HIT000320894_08.4.
DR   H-InvDB; HIT000320894_09.4.
DR   H-InvDB; HIT000320894_10.4.
XX
CC   In the genomic sequence from ref [2] the mature protein starts
CC   with Ser (position 387 in this cDNA sequence).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1643
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             153..854
FT                   /note="TNF precursor"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="H-InvDB:HIT000320894_04.4"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:4TWT"
FT                   /db_xref="PDB:4Y6O"
FT                   /db_xref="PDB:5MU8"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="CAA25650.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   sig_peptide     153..380
FT                   /note="put. signal peptide (aa -76 to -1)"
FT   mat_peptide     381..851
FT                   /note="mature TNF (aa 1-157)"
FT   misc_feature    1630..1635
FT                   /note="put. polyadenylation signal"
XX
SQ   Sequence 1643 BP; 370 A; 495 C; 398 G; 380 T; 0 other;
     gcagaggacc agctaagagg gagagaagca actacagacc ccccctgaaa acaaccctca        60
     gacgccacat cccctgacaa gctgccaggc aggttctctt cctctcacat actgacccac       120
     ggctccaccc tctctcccct ggaaaggaca ccatgagcac tgaaagcatg atccgggacg       180
     tggagctggc cgaggaggcg ctccccaaga agacaggggg gccccagggc tccaggcggt       240
     gcttgttcct cagcctcttc tccttcctga tcgtggcagg cgccaccacg ctcttctgcc       300
     tgctgcactt tggagtgatc ggcccccaga gggaagagtt ccccagggac ctctctctaa       360
     tcagccctct ggcccaggca gtcagatcat cttctcgaac cccgagtgac aagcctgtag       420
     cccatgttgt agcaaaccct caagctgagg ggcagctcca gtggctgaac cgccgggcca       480
     atgccctcct ggccaatggc gtggagctga gagataacca gctggtggtg ccatcagagg       540
     gcctgtacct catctactcc caggtcctct tcaagggcca aggctgcccc tccacccatg       600
     tgctcctcac ccacaccatc agccgcatcg ccgtctccta ccagaccaag gtcaacctcc       660
     tctctgccat caagagcccc tgccagaggg agaccccaga gggggctgag gccaagccct       720
     ggtatgagcc catctatctg ggaggggtct tccagctgga gaagggtgac cgactcagcg       780
     ctgagatcaa tcggcccgac tatctcgact ttgccgagtc tgggcaggtc tactttggga       840
     tcattgccct gtgaggagga cgaacatcca accttcccaa acgcctcccc tgccccaatc       900
     cctttattac cccctccttc agacaccctc aacctcttct ggctcaaaaa gagaattggg       960
     ggcttagggt cggaacccaa gcttagaact ttaagcaaca agaccaccac ttcgaaacct      1020
     gggattcagg aatgtgtggc ctgcacagtg aattgctggc aaccactaag aattcaaact      1080
     ggggcctcca gaactcactg gggcctacag ctttgatccc tgacatctgg aatctggaga      1140
     ccagggagcc tttggttctg gccagaatgc tgcaggactt gagaagacct cacctagaaa      1200
     ttgacacaag tggaccttag gccttcctct ctccagatgt ttccagactt ccttgagaca      1260
     cggagcccag ccctccccat ggagccagct ccctctattt atgtttgcac ttgtgattat      1320
     ttattattta tttattattt atttatttac agatgaatgt atttatttgg gagaccgggg      1380
     tatcctgggg gacccaatgt aggagctgcc ttggctcaga catgttttcc gtgaaaacgg      1440
     agctgaacaa taggctgttc ccatgtagcc ccctggcctc tgtgccttct tttgattatg      1500
     ttttttaaaa tatttatctg attaagttgt ctaaacaatg ctgatttggt gaccaactgt      1560
     cactcattgc tgagcctctg ctccccaggg gagttgtgtc tgtaatcgcc ctactattca      1620
     gtggcgagaa ataaagtttg ctt                                              1643
//