spacer

EBI Dbfetch

ID   X00810; SV 1; linear; genomic DNA; STD; MUS; 109 BP.
XX
AC   X00810;
XX
DT   20-FEB-1985 (Rel. 05, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 12)
XX
DE   Mouse Ren1 gene for renin (exon 1)
XX
KW   renin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-109
RX   PUBMED; 6370686.
RA   Holm I., Ollo R., Panthier J.J., Rougeon F.;
RT   "Evolution of aspartyl proteases by gene duplication: the mouse renin gene
RT   is organized in two homologous clusters of four exons";
RL   EMBO J. 3(3):557-562(1984).
XX
DR   MD5; 21d94ce0de3f6519f2c2001f97faada6.
DR   EPD; EP15035; MM_RENI.
DR   EPD; EP15036; MM_RENS.
DR   Ensembl-Gn; ENSMUSG00000070645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094556; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..109
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(62..99,X00811.1:11..161,X00812.1:11..134,
FT                   X00813.1:11..138,X00814.1:11..207,X00815.1:11..130,
FT                   X00816.1:11..155,X00850.1:11..109,X00851.1:11..172)
FT                   /gene="ren1"
FT                   /product="renin"
FT                   /db_xref="GOA:P06281"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012848"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="MGI:MGI:97898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06281"
FT                   /protein_id="CAA25391.1"
FT                   /translation="MDRRRIRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTK
FT                   RPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLAC
FT                   GIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVSRVGGITVTQTFGEVTEL
FT                   PLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEV
FT                   VLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAP
FT                   TSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRD
FT                   KLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR"
FT   mRNA            join(<62..99,X00811.1:11..161,X00812.1:11..134,
FT                   X00813.1:11..138,X00814.1:11..207,X00815.1:11..130,
FT                   X00816.1:11..155,X00850.1:11..109,X00851.1:11..351)
FT   exon            <62..99
FT                   /number=1
XX
SQ   Sequence 109 BP; 32 A; 23 C; 33 G; 21 T; 0 other;
     tataaaagaa ggctcagggg gtctgggcta cacagctctt agaaagcctt ggctgaacca        60
     gatggacaga aggaggatac gcaccgctac ctttgaacgg taacttggg                   109
//


spacer
spacer