Dbfetch

ID   X00699; SV 1; linear; mRNA; STD; HUM; 1115 BP.
XX
AC   X00699;
XX
DT   07-NOV-1985 (Rel. 07, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human mRNA fragment for class II histocompatibility antigen beta-chain
DE   (pII-beta-3)
XX
KW   histocompatibility antigen; signal peptide.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1115
RX   PUBMED; 6589154.
RA   Peterson P.A., Gustafsson K., Wiman K.G., Emmoth E., Larhammar D.,
RA   Boehme J., Hyldig-Nielsen J.J., Ronne H., Rask L.;
RT   "Mutations and selection in the generation of class II histocompatibility
RT   antigen polymorphism";
RL   EMBO J. 3(7):1655-1661(1984).
XX
DR   MD5; cf7e23cd2e528a3ee834a72a92373e6d.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   EuropePMC; PMC1241275; 12634122.
DR   H-InvDB; HIT000320877_04.4.
XX
CC   Data kindly reviewed (11-FEB-1986) by K. Gustafsson
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1115
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             36..836
FT                   /note="precursor"
FT                   /db_xref="GOA:P01912"
FT                   /db_xref="H-InvDB:HIT000320877_03.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1A6A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01912"
FT                   /protein_id="CAA25295.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRV
FT                   DNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   sig_peptide     36..123
FT                   /note="signal peptide (aa -29 to -1)"
FT   mat_peptide     124..833
FT                   /note="mature beta-chain (aa 1 to 237)"
XX
SQ   Sequence 1115 BP; 230 A; 300 C; 323 G; 262 T; 0 other;
     ctgctctggc ccctggtcct gtcctgttct ccagcatggt gtgtctgagg ctccctggag        60
     gctcctgcat ggcagttctg acagtgacac tgatggtgct gagctcccca ctggctttgg       120
     ctggggacac cagaccacgt ttcttggagt actctacgtc tgagtgtcat ttcttcaatg       180
     ggacggagcg ggtgcggtac ctggacagat acttccataa ccaggaggag aacgtgcgct       240
     tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct gatgccgagt       300
     actggaacag ccagaaggac ctcctggagc agaagcgggg ccgggtggac aactactgca       360
     gacacaacta cggggttgtg gagagcttca cagtgcagcg gcgagtccat cctaaggtga       420
     ctgtgtatcc ttcaaagacc cagcccctgc agcaccataa cctcctggtc tgttctgtga       480
     gtggtttcta tccaggcagc attgaagtca ggtggttccg gaatggccag gaagagaaga       540
     ctggggtggt gtccacaggc ctgatccaca atggagactg gaccttccag accctggtga       600
     tgctggaaac agttcctcgg agtggagagg tttacacctg ccaagtggag cacccaagcg       660
     tgacaagccc tctcacagtg gaatggagag cacggtctga atctgcacag agcaagatgc       720
     tgagtggagt cgggggcttt gtgctgggcc tgctcttcct tggggccggg ctgttcatct       780
     acttcaggaa tcagaaagga cactctggac ttcagccaag aggattcctg agctgaagtg       840
     cagatgacac attcaaagaa gaactttctg ccccagcttt gcaggatgaa aagctttccc       900
     tcctggctgt tattcttcca caagagaggg ctttctcagg acctggttgc tactggttca       960
     gcaactgcag aaaatgtcct cccttgtggc ttcctcagct cctgttcttg gcctgaagcc      1020
     ccacagcttt gatggcagtg cctcatcttc aacttttgtg ctcccctttg cctaaaccct      1080
     atggcctcct gtgcatctgt actcaccctg tacca                                 1115
//