Dbfetch

ID   V00743; SV 1; linear; mRNA; STD; MUS; 2009 BP.
XX
AC   V00743;
XX
DT   13-JUL-1983 (Rel. 03, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Mouse mRNA encoding alpha-fetoprotein (a fetal serum protein)
XX
KW   complementary DNA; fetoprotein; signal peptide.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2009
RX   DOI; 10.1038/291201a0.
RX   PUBMED; 6164927.
RA   Law S.W., Dugaiczyk A.;
RT   "Homology between the primary structure of alpha-fetoprotein, deduced from
RT   a complete cDNA sequence, and serum albumin";
RL   Nature 291(5812):201-205(1981).
XX
DR   MD5; 1381c8bdb0f11c69386304f71b91c6db.
DR   Ensembl-Gn; ENSMUSG00000054932; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029722; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029688; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029634; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029698; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029421; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030152; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028831; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029391; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029535; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029494; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029623; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029523; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030186; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028550; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028910; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000042755; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072546; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072625; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0072539; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072552; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072195; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073019; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072739; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0072152; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0072283; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0072186; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0072339; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072188; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073233; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072207; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071342; mus_musculus_wsbeij.
DR   EuropePMC; PMC186328; 11937486.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2009
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            1..2009
FT   CDS             42..1859
FT                   /note="alpha fetoprotein"
FT                   /db_xref="GOA:P02772"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87951"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02772"
FT                   /protein_id="CAA24118.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   polyA_site      2009
XX
SQ   Sequence 2009 BP; 589 A; 465 C; 474 G; 481 T; 0 other;
     tcccacttcc agcactgcct gcggtgaagg aacaagcagc catgaagtgg atcacacccg        60
     cttccctcat cctcctgcta catttcgctg cgtccaaagc attgcacgaa aatgagtttg       120
     ggatagcttc cacgttagat tcctcccagt gcgtgacgga gaagaatgtg cttagcatag       180
     ctaccatcac ctttacccag tttgttccgg aagccaccga ggaggaagtg aacaaaatga       240
     ctagcgatgt gttggctgca atgaagaaaa actctggcga tgggtgttta gaaagccagc       300
     tatctgtgtt tctggatgaa atttgccatg agacggaact ctctaacaag tatggactct       360
     caggctgctg cagccaaagt ggagtggaaa gacatcagtg tctgctggca cgcaagaaga       420
     ctgctccggc ctctgtccca cccttccagt ttccagaacc tgccgagagt tgcaaagcac       480
     atgaagaaaa cagggcagtg ttcatgaaca ggttcatcta tgaagtgtca aggaggaacc       540
     ccttcatgta tgccccagcc attctgtcct tggctgctca gtacgacaag gtcgttctgg       600
     catgctgcaa agctgacaac aaggaggagt gcttccagac aaagagagca tccattgcaa       660
     aggaattaag agaaggaagc atgttaaatg agcatgtatg ttcagtgata agaaaatttg       720
     gatcccgaaa cctccaggca acaaccatta ttaagctaag tcaaaagtta actgaagcaa       780
     attttactga gattcagaag ctggccctgg atgtggctca catccacgag gagtgttgcc       840
     aaggaaactc gctggagtgt ctgcaggatg gggaaaaagt catgacatat atatgttctc       900
     aacaaaatat tctgtcaagc aaaatagcag agtgctgcaa attacccatg atccaactag       960
     gcttctgcat aattcacgca gagaatggcg tcaaacctga aggcttatct ctaaatccaa      1020
     gccagttttt gggagacaga aattttgccc aattttcttc agaggaaaaa atcatgttca      1080
     tggcaagctt tcttcatgaa tactcaagaa ctcaccccaa ccttcctgtc tcagtcattc      1140
     taagaattgc taaaacgtac caggaaatat tggagaagtg ttcccagtct ggaaatctac      1200
     ctggatgtca ggacaatctg gaagaagaat tgcagaaaca catcgaggag agccaggcac      1260
     tgtccaagca aagctgcgct ctctaccaga ccttaggaga ctacaaatta caaaatctgt      1320
     tccttattgg ttacacgagg aaagcccctc agctgacctc agcagagctg atcgacctca      1380
     ccgggaagat ggtgagcatt gcctccacgt gctgccagct cagcgaggag aaatggtccg      1440
     gctgtggtga gggaatggcc gacattttca ttggacattt gtgtataagg aatgaagcaa      1500
     gccctgtgaa ctctggtatc agccactgct gcaactcttc gtattccaac aggaggctat      1560
     gcatcaccag ttttctgagg gatgaaacct atgcccctcc cccattctct gaggataaat      1620
     tcatcttcca caaggatctg tgccaagctc agggcaaagc cctacagacc atgaaacaag      1680
     agcttctcat taacctggtg aagcaaaagc ctgaactgac agaggagcag ctggcggctg      1740
     tcactgcaga tttctcgggc cttttggaga agtgctgcaa agcccaggac caggaagtct      1800
     gtttcacaga agagggtcca aagttgattt ccaaaactcg tgatgctttg ggcgtttaaa      1860
     catctccaga aggaagagtg gacaaaaaaa tgtgttgacg ctttggtgtg agccttttgg      1920
     cttaactgta actgctagta ctttaaccac atggtgaaga tgtccatgtg agatttctat      1980
     accttaggaa taaaaacttt tcaactatt                                        2009
//