Dbfetch

ID   U97554; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   U97554;
XX
DT   27-MAY-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 (DRB1*13 variant) gene, exon 2,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lester S., Laham N., Humphreys I., McCluskey J.;
RT   "A new DRB1*13 allele detected by PCR-SSOP and confirmed by sequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lester S., Laham N., Humphreys I., McCluskey J.;
RT   ;
RL   Submitted (15-APR-1997) to the INSDC.
RL   Immunogenetics Laboratory, Australian Red Cross Blood Service, South
RL   Australia, 301 Pirie Street, Adelaide, South Australia 5000, Australia
XX
DR   MD5; 1b92394372a3df5c9f3dfd4a8f97657b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*13-DQB1*0603-DRB3*0202"
FT                   /cell_line="AD-21111"
FT                   /cell_type="B lymphoblastoid"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*13"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen HLA-DRB1"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:32"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAB58309.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 66 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//