Dbfetch

ID   U96635; SV 1; linear; mRNA; STD; MUS; 5581 BP.
XX
AC   U96635;
XX
DT   16-MAY-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus ubiquitin protein ligase Nedd-4 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5581
RX   DOI; 10.1074/jbc.272.24.15085.
RX   PUBMED; 9182527.
RA   Hatakeyama S., Jensen J.P., Weissman A.M.;
RT   "Subcellular localization and ubiquitin-conjugating enzyme (E2)
RT   interactions of mammalian HECT family ubiquitin protein ligases";
RL   J Biol Chem 272(24):15085-15092(1997).
XX
RN   [2]
RP   1-5581
RA   Hatakeyama S., Jensen J.P., Weissman A.M.;
RT   ;
RL   Submitted (07-APR-1997) to the INSDC.
RL   Laboratory of Immune Cell Biology, Division of Basic Sciences, National
RL   Cancer Institute, National Institutes of Health, 9000 Rockville Pike,
RL   Bethesda, MD 20892-1152, USA
XX
RN   [3]
RC   Protein translation update by submitter
RP   1-5581
RA   Hatakeyama S.;
RT   ;
RL   Submitted (17-JUL-1997) to the INSDC.
RL   Laboratory of Immune Cell Biology, Division of Basic Sciences, National
RL   Cancer Institute, National Institutes of Health, 9000 Rockville Pike,
RL   Bethesda, MD 20892-1152, USA
XX
DR   MD5; 8505864970a2ba1818aba91c26b1b163.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035017; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034998; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034927; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034990; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034699; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035509; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034021; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034672; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034831; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034773; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034912; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034814; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035531; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033725; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034133; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093146; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0093233; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093178; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093155; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0092730; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0093675; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093344; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0092658; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0092867; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0092714; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0092875; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0092707; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0093988; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0092756; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0091743; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5581
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6 x CBA"
FT                   /mol_type="mRNA"
FT                   /note="F1"
FT                   /db_xref="taxon:10090"
FT   CDS             612..2945
FT                   /codon_start=1
FT                   /product="Nedd-4"
FT                   /note="ubiquitin protein ligase"
FT                   /db_xref="GOA:P46935"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="PDB:3M7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46935"
FT                   /protein_id="AAB63360.1"
FT                   /translation="MSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENR
FT                   LTRDDFLGQVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNG
FT                   SEDENADQAEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESR
FT                   RTQWKRPSPDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVREDEN
FT                   TEYSGQAVQSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQTCIF
FT                   EEQPTLPVLLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHL
FT                   RGKTDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITGPAVPYSRDY
FT                   KRKYEFFRRKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLWIEFDGEK
FT                   GLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGR
FT                   VAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTELDLR
FT                   FIIDEELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFE
FT                   LIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWMMDS
FT                   EKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLPPY
FT                   ESFDELWDKLQMAIENTQGFDGVD"
XX
SQ   Sequence 5581 BP; 1584 A; 1273 C; 1260 G; 1464 T; 0 other;
     cggagagccc gagcctgatg aggctcagtc ctgccctggt cctcaaggtc cctggtttaa        60
     cttctcagcc cagataccct gtgatgctgc tcctacacca cctcctgcag tctctgagga       120
     ccaacctact ccctccctcc agctgctggc ctcctctaaa ccaatgaata cacccggtgc       180
     tgccaatcct tgttccccag tgcagctctc ttcctctctc cttctctctc ggtctctcgc       240
     tctctctcgc cgctgcagcc tagtaggggc gcttcgtcca gcatgagctc ggacatggca       300
     gccgacgagt cgagcgccca gtactctcgg aggacgaggt atgggagttt tgcctggata       360
     agacagaaga tggtggcgga tcccccggaa gtgatgttac agatacttgt gagcctccat       420
     gtggatgctg ggagttgaat ccgaattccc tggaagagga gcacgtgctg ttcactgctg       480
     atccgtacct ggagctccac aacgatgaca cacgagttgt gagagtgaag gttatagctg       540
     gcataggcct ggccaagaaa gacatcttgg gagccagtga tccttacgta agagtgacat       600
     tgtatgaccc gatgagtgga atccttacca gcgtgcagac aaaaactatc aaaaagtctt       660
     tgaatccaaa atggaatgaa gaaatactgt tcagggtcct tccacagcga caccgcattc       720
     ttttcgaagt gtttgatgaa aaccgtttga caagagatga tttcctaggt caagtggatg       780
     tccctctcta tcctttaccg actgaaaacc caagaatgga gagaccatat acatttaagg       840
     attttgttct tcatccaaga agtcacaaat caagagttaa aggttatctg agattaaaaa       900
     tgacttattt acctaaaaat ggctcagaag atgaaaatgc agaccaggct gaggagttag       960
     agcctggctg ggttgttttg gaccaaccag atgctgccac tcatttgccg catccaccag      1020
     aaccctctcc cctacctcca ggatgggaag agaggcagga tgtccttgga aggacctact      1080
     acgtaaacca tgaatctaga agaacacagt ggaaaaggcc aagccctgac gatgacctca      1140
     cggatgaaga caatgatgat atgcagctgc aagcgcagcg agcattcacc accaggcggc      1200
     agatatcgga ggatgtggat ggccctgaca accgggagtc ccctgagaat tgggaaatcg      1260
     tacgagaaga tgaaaacacc gagtatagtg gtcaggctgt ccagtcacct ccatcgggtc      1320
     acattgatgt gcagactcac cttgcagaag agtttaatac cagacttgcc gtgtgtggaa      1380
     atccagccac cagccagccg gttaccagct caaatcattc cagcagagga ggcagcttgc      1440
     agacctgtat ctttgaggaa cagcctacac ttcctgtgct tttgcctact tcatctggat      1500
     tgccaccagg ttgggaagaa aaacaagatg acagaggaag atcatactat gtagaccaca      1560
     actctaaaac caccacatgg tccaagccca ccatgcagga tgatccaaga tcgaaaatcc      1620
     ctgctcatct gagaggaaag actgactcca atgacctggg acccttacct ccaggctggg      1680
     aagaaagaac ccacacagat gggcgagtct tcttcataaa ccacaatata aagaagaccc      1740
     agtgggaaga tcctcgcctg cagaacgtgg caatcactgg accagcagtg ccctactcca      1800
     gagattacaa gagaaagtac gagttcttca gaaggaagct caagaagcag actgacattc      1860
     caaacaaatt tgaaatgaag cttcgccgcg caaacattct ggaggattct taccggagga      1920
     ttatgggtgt gaagagagct gacttgctca aggccagact ctggattgag tttgatggtg      1980
     aaaagggcct tgactatgga ggggttgcca gagagtggtt cttcctcatc tcgaaggaaa      2040
     tgttcaaccc ttactacggc ctgtttgaat attctgctac ggataattac accctacaga      2100
     taaatcctaa ctcgggcttg tgtaatgaag atcacctctc atacttcaag ttcattggcc      2160
     gtgtggctgg gatggcagtt tatcatggca agctgttgga tgggtttttc atccgtccgt      2220
     tttacaagat gatgcttcag aaactgataa cactgcacga catggagtcc gtggatagtg      2280
     aatattacag ttctctgcga tggattcttg aaaatgaccc gacggagctg gacctgagat      2340
     ttatcataga tgaagaactt tttggacaga cacatcagca cgaactgaaa accggaggat      2400
     cagagattgt tgtcaccaat aagaacaaaa aggagtatat ctaccttgta atacaatggc      2460
     gatttgtgaa ccgtatccag aagcaaatgg cagcttttaa agagggattt tttgaactga      2520
     taccacagga tctcatcaag atatttgatg aaaatgagct agagcttctc atgtgtggtc      2580
     tgggagatgt ggatgtgaac gactggcggg aacacacaaa atacaaaaat ggctacagca      2640
     tgaaccacca ggtcatccac tggttctgga aggctgtttg gatgatggat tcggaaaaaa      2700
     gaatacgctt acttcagttt gtcactggca catcccgtgt gccgatgaat gggtttgctg      2760
     aactctatgg ctcgaatgga ccacaatcct tcacagtgga acaatggggc acccctgata      2820
     agctgccaag agcacacacc tgcttcaatc gcctggacct gccaccctac gaatcctttg      2880
     acgaactctg ggataaactt cagatggcaa ttgagaacac acagggcttt gatggcgttg      2940
     attagattac aaaaaaaaac aagctgtggt gtcttgtaca ccatagtttc taagcaaaag      3000
     caaaaacaaa atcacatttt aacattttcc agatagtttc taaaagatgg tcactggctc      3060
     ttcccaccga gaccagagga cagtttatcc atgatttagc caccaccatg ctgacctgtt      3120
     cacttgtcca gttactttgt ccagttgttg gggttcatgt gtacggcagg atgtgagtcc      3180
     tgtacgcctg agttcttacc ctatctcatc ttgctaggca catccttctg aaactactga      3240
     gattccaact gtgaaatatc tgtaatgagt agctggtggg aaaaatttga tgctttttaa      3300
     agatgaaatt tggacaaaga aagtctttaa tgattagtat actgcgacat acttagtacc      3360
     acatgtcgct acttattctg tagacctgcc tagtgtacct tatcgcctag aaccttgaag      3420
     ccgctttggt tgatgtatca cacgtgtttt tagtcactta agtcactagt gtttaaaaaa      3480
     aaaaatgtac tcttcacttg ggaagtattt cacgtttgtt agcatgcagc ttgagcctta      3540
     acaggcgatt atggagacaa gtggagcaag cttttattgc agtgtgtagt gagtcttagg      3600
     cctccttttt gcctgtgcat cctaaggcta gagtcattat gtgttagtgc gttagaattc      3660
     cttcaaacac gaaacaagct ccacaacgca gtgtttctaa gcatgccgtg aagaaccgag      3720
     ttccatgtat gacttgccct taccagccac tcttcacgct tgcagtcacg tagtacatac      3780
     gtgtttacgg agttcattat gtttacagat taagcgaatt tctgtagttg catttttata      3840
     tttttagtat cacattagta tataaaaatt tgtttaaaat aaccaaagag tagttcaatg      3900
     cataatttgt atgaatttgt taccaagttt cttatgcttt ctaaaaaaat actgtttcct      3960
     atgaaaatta tgtttaatca aaagtcaaga acccttgggg caaaatgcta caggtggagt      4020
     cccaccatag tcacctttga ggcacaggaa gaggttccat gcatgaatct gcacacatga      4080
     gcagtgctgg ctgctgtgca ccgggccctt gggatgaagc catcagcact gacatccagc      4140
     cccgtcttca tcctcaggct tagaaacaag tgggatggtg actttacagt cagtgggaac      4200
     taagagcccg cagaataaca aaggcagaag gacaggaaag cgaggtccga gtccgactgc      4260
     gaggtcatat ctgccaaggc tccttctagt cagcttacac tggtgattat acggaaaatg      4320
     ctctagatat gagaaaagca atgtggcatg taatgagtta ggtaagcttg tgttataaac      4380
     tttccgaatg cttataagta gcctgtggga gctgtaagaa atacttgggg ccattgattt      4440
     aagcttgttg gctctaacat gactaatacc tgtcagccca tggtagggat ttcagtgaca      4500
     gtagtggaaa cgctttccac agaccacacc actatgttga tcggtgaaag acacccccag      4560
     gccagtgcat gcttccagag tgtcctgatc agtcagccag catggccacc gtccagtgtt      4620
     gatttttatc attagccagc tgagcctgca gcacggggct catttccccg tctggcagat      4680
     gtggatagct gggcccactc attctgtctc tcaaggctat ggtaagttct taaaggggta      4740
     cttttctgca agccaccaga gtctgagtca gctgtcccct cccagaaagc atgttcacct      4800
     aaagtgattt agcctaggcg aggaggatcc ctactacgtg ctggattatg tgtgtgttca      4860
     tgaaaggatt tcagcgtcaa aagttcactt cctccatagt ggcaaaataa cactaatatg      4920
     ggctggtgtg ttatctggag tgcccccatt gtgtggaact aagggtgaaa acagaacggt      4980
     acacggttgt tcagtgtcgt ccccagaact catccccagc agggcttaga aaacacgagc      5040
     ttccttcctc cttcacactc attttccttt ggatgattca gtgacatcac agaacctggt      5100
     gtccccctcc ctaccccagg tgtgtagtaa tgtccgaagg gaccctggct ggaacaccac      5160
     tgccccccat gctagtgcat gaaaacatct cgttatattc taccactggg gcattgtgga      5220
     gtcacattca cgaaacacga agaccttgta cttctctaga aaagtgtttt agcctacttt      5280
     ttctctaatc cccaccccaa caaatgaaac acaaaattgc attacaaaag caaacccaaa      5340
     tggtatttgt tttcgatttt atttataccg ctcgagttat tccttatacg tatcaagtta      5400
     aactcaattg gttttaatga taagctattt gacattgttt ttaaattttt tcttatatgg      5460
     taaatgtata tccagattta aggtatcgaa atttattgca taaactataa aatcattttc      5520
     aaaaatctca attccacaaa taaagttcta ttctgatttt aaaaaaaaaa aaaaaaaaaa      5580
     a                                                                      5581
//