spacer

EBI Dbfetch

ID   U95115; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   U95115;
XX
DT   06-MAY-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen (HLA-D) gene, HLA-DRB1 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Greville W.D., Dunckley H.;
RT   ;
RL   Submitted (25-MAR-1997) to the INSDC.
RL   Molecular Genetics, NSW Red Cross Blood Transfusion Service, 153 Clarence
RL   Street, Sydney, NSW 2000, Australia
XX
RN   [2]
RC   Sequence update by submitter
RP   1-270
RA   Greville W.D., Dunckley H.;
RT   ;
RL   Submitted (31-OCT-2006) to the INSDC.
RL   Molecular Genetics, NSW Red Cross Blood Transfusion Service, 153 Clarence
RL   Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 40f0cf8f3dc5a31dbb4e11fa23596534.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
CC   On Oct 31, 2006 this sequence version replaced gi:2058734.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-D"
FT                   /allele="HLA-DRB1"
FT   mRNA            <1..>270
FT                   /gene="HLA-D"
FT                   /allele="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-D"
FT                   /allele="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:30"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAB58397.2"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 56 A; 66 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer