Dbfetch

ID   U91905; SV 1; linear; mRNA; STD; MUS; 1786 BP.
XX
AC   U91905;
XX
DT   03-APR-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus Fritz (mfiz) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1786
RX   DOI; 10.1016/S0925-4773(97)00035-X.
RX   PUBMED; 9178261.
RA   Mayr T., Deutsch U., Kuhl M., Drexler H.C.A., Lottspeich F., Deutzmann R.,
RA   Wedlich D., Risau W.;
RT   "Fritz: a secreted frizzled-related protein that inhibits Wnt activity";
RL   Mech. Dev. 63(1):109-125(1997).
XX
RN   [2]
RP   1-1786
RA   Mayr T., Deutsch U., Kuehl M., Drexler H.C.A., Lottspeich F., Deutzmann R.,
RA   Wedlich D., Risau W.;
RT   ;
RL   Submitted (04-MAR-1997) to the INSDC.
RL   Molecular Cell Biology, Kerckhoff Institute, Parkstrasse 1, Bad Nauheim
RL   61231, Germany
XX
DR   MD5; 876fc398deabb38d41e231099a8d297d.
DR   Ensembl-Gn; ENSMUSG00000027004; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026303; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025078; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025597; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025728; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025816; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025721; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025147; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000028389; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0055544; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055247; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055453; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055305; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055405; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0055255; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0055052; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054520; mus_musculus_wsbeij.
DR   EuropePMC; PMC2551686; 18599526.
DR   EuropePMC; PMC3058974; 21239498.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1786
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             799..1770
FT                   /codon_start=1
FT                   /gene="mfiz"
FT                   /product="Fritz"
FT                   /function="inhibits Wnt activity"
FT                   /note="frizzled protein homolog"
FT                   /db_xref="GOA:P97401"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026556"
FT                   /db_xref="MGI:MGI:892032"
FT                   /db_xref="PDB:1IJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97401"
FT                   /protein_id="AAB51300.1"
FT                   /translation="MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKS
FT                   LPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEP
FT                   IKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPM
FT                   DSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEI
FT                   LKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDR
FT                   LGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPARS"
XX
SQ   Sequence 1786 BP; 387 A; 532 C; 487 G; 373 T; 7 other;
     ggcacgagtg gggaccaagg gttcgtctat ggatccagag ccgggggtgg agtggngaaa        60
     ggtgtgcggc tcctgtcggg agctgcctgg ggctacagca tcacagatag acagggtctc       120
     acactccagt cccctgaaaa ctcaaagcct tctcggaagg aggagccgga gggcagggga       180
     ccgcggggcg gagctcttgt cggccgaggt gggaaggctc agctncgagc caagccgctg       240
     acctcctctg agctcctctg cccgctcgca ggatcttccc gacccctgca ggacttgggc       300
     aaactcccac ctccgctccc attagtcctc ccacccccac caaatctcct ccctcggagg       360
     tcccctatcc atctcacttt gcagaattta tcgcttcttc caacacccca caccttttcc       420
     acacccaaga ctccgatccc ttactgaatt tgacttttgt tttaatttct ctctggcttc       480
     ctcttctgcc ccctcatctg attgatgtgc taaggctgat gtctctgcca gagcgagagg       540
     aataaataga tgctgcctcg cctagaggct taagacgctt gggaagagca rccggcgcag       600
     cgaggcaccg ggctccscca agctagtggg accggacctg ggagcacttg gatccaagag       660
     asytgtgatt gtcccagggg tgggggcagc tccccaggtc ggtgggatca cccctcggaa       720
     ccgcaggggg agacttcgga rcgaaagtgt ctcccgcgtc cgtcgctcgg ctgcgccctg       780
     ccccatcctg ctgggaccat ggtctgctgc ggcccgggac ggatgctgct aggatgggcc       840
     gggttgctag tcctggctgc tctctgcctg ctccaggtgc ccggagctca ggctgcagcc       900
     tgtgagcctg tccgcatccc gctgtgcaag tcccttccct ggaacatgac caagatgccc       960
     aaccacctgc accacagcac ccaggctaac gccatcctgg ccatggaaca gttcgaaggg      1020
     ctgctgggca cccactgcag cccggatctt ctcttcttcc tctgtgcaat gtacgcaccc      1080
     atttgcacca tcgacttcca gcacgagccc atcaagccct gcaagtctgt gtgtgagcgc      1140
     gcccgacagg gctgcgagcc cattctcatc aagtaccgcc actcgtggcc ggaaagcttg      1200
     gcctgcgacg agctgccggt gtacgaccgc ggcgtgtgca tctctcctga ggccatcgtc      1260
     accgcggacg gagcggattt tcctatggat tcaagtactg gacactgcag aggggcaagc      1320
     agcgaacgtt gcaaatgtaa gcctgtcaga gctacacaga agacctattt ccggaacaat      1380
     tacaactatg tcatccgggc taaagttaaa gaggtaaaga tgaaatgtca tgatgtgacc      1440
     gccgttgtgg aagtgaagga aattctaaag gcatcactgg taaacattcc aagggacacc      1500
     gtcaatcttt ataccacctc tggctgcctc tgtcctccac ttactgtcaa tgaggaatat      1560
     gtcatcatgg gctatgaaga cgaggaacgt tccaggttac tcttggtaga aggctctata      1620
     gctgagaagt ggaaggatcg gcttggtaag aaagtcaagc gctgggatat gaaactccga      1680
     caccttggac tgggtaaaac tgatgctagc gattccactc agaatcagaa gtctggcagg      1740
     aactctaatc cccggccagc acgcagctaa atcctgaaat gtaaaa                     1786
//