spacer

EBI Dbfetch

ID   U90657; SV 1; linear; genomic DNA; STD; MUS; 1674 BP.
XX
AC   U90657;
XX
DT   09-SEP-1997 (Rel. 52, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Mus musculus galanin receptor (Galnr) gene, exon 3 and complete cds.
XX
KW   G protein-coupled receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1674
RX   DOI; 10.1006/geno.1997.4960.
RX   PUBMED; 9367674.
RA   Jacoby A.S., Webb G.C., Liu M.L., Kofler B., Hort Y.J., Fathi Z.,
RA   Bottema C.D.K., Shine J., Iismaa T.P.;
RT   "Structural organization of the mouse and human GALR1 galanin receptor
RT   genes (Galnr and GALNR) and chromosomal localization of the mouse gene";
RL   Genomics 45(3):496-508(1997).
XX
RN   [2]
RP   1-1674
RA   Jacoby A.S.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Neurobiology Programme, The Garvan Institute of Medical Research, 384
RL   Victoria St, Sydney, NSW 2010, Australia
XX
DR   MD5; f7ba635bff18fba3f6f074cdbdc4a386.
DR   Ensembl-Gn; ENSMUSG00000024553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065224; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1674
FT                   /organism="Mus musculus"
FT                   /map="18E3-4"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   intron          <1..190
FT                   /gene="Galnr"
FT                   /number=2
FT   mRNA            join(U90655.1:396..1704,U90656.1:30..95,191..>1674)
FT                   /gene="Galnr"
FT   CDS             join(U90655.1:1042..1704,U90656.1:30..95,191..508)
FT                   /codon_start=1
FT                   /gene="Galnr"
FT                   /product="galanin receptor"
FT                   /db_xref="GOA:P56479"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000405"
FT                   /db_xref="InterPro:IPR003906"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1096364"
FT                   /protein_id="AAB87748.1"
FT                   /translation="MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFA
FT                   MGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLG
FT                   AFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALS
FT                   IAMASPVAYHQRLFHRDSNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKV
FT                   LNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASF
FT                   FFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTP
FT                   PSTNCTHV"
FT   exon            191..>1674
FT                   /gene="Galnr"
FT                   /number=3
FT   repeat_region   complement(1063..1194)
FT                   /rpt_family="B1"
FT   repeat_region   1264..1335
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="GGGAGA"
FT                   /note="hexanucleotide"
FT   polyA_signal    1650..1657
FT                   /gene="Galnr"
XX
SQ   Sequence 1674 BP; 401 A; 439 C; 369 G; 465 T; 0 other;
     ctggtgtgtc tgaagactgt tacagtgaac tgcacatata ataataagta aatttttaaa        60
     aaagaaagtt ttttaaataa ataaatgcta cagaggtgta ttttacagcg ctgtattctc       120
     ctgatataac tggtgtattc ctgcagctcc tgtcccctct ccaaccctct tccattactc       180
     tctcttccag actgcacaga ccgtcctggt ggtcgttgta gtatttggca tatcctggct       240
     gccccatcat gtcgtccacc tctgggctga gtttggagcc ttcccactga cgccagcttc       300
     cttcttcttc agaatcaccg cccattgcct ggcatacagc aactcctcag tgaaccccat       360
     catatatgcc tttctctcag aaaacttccg gaaggcgtac aagcaagtgt tcaagtgtca       420
     tgtttgcgat gaatctccac gcagtgaaac taaggaaaac aagagccgga tggacacccc       480
     gccatccacc aactgcaccc acgtgtgaag gtttgcggga gcctcccgac ttccagctcc       540
     catgtgtgtt agagagagga gggcggagcg aattatcaag taacatggca gcttattctc       600
     cacagcaatt cctatcgatc caactacatt ccacagtggt aaaaggacgt tgattgttca       660
     gggaactcgt gggtctactg aagatcattt tccaatttca ttttactcta taattgtata       720
     tatgagacaa aagaaacttc tgtatagttt ctagctctca aggaatgaaa gtcctacagc       780
     actctgcaaa tgttttgatg catgccccag ccttccctcc cagtctgcct cagtatcctc       840
     gggcttccgc cactcgtgcc tcattgtttt ttgtttgttt gtttgttttt ggtattttga       900
     aatagggttt ctctgtgtag ccctggctgt cctgaactca ctctgtagac caggctggcc       960
     tagaactcag aaatctgcct gcctctgcct cccaagtgct gggattaaag gtgtgcacca      1020
     ccactgcccg gccctgcctc attgttttaa ctgcatgtgg gacagtctct agtgggccac      1080
     atccttttgt gggtggagtc tcctgtgagc tcagatctgc tctgttcaga aatacagaat      1140
     caaacagaag gggctgctgt agttggccaa ctaatctcta ctcgaatcac ccggcgatgc      1200
     tggggtgttc ctcactattc accccaatgt tccaggttcc cgaatgaaat acacacagac      1260
     agagggagag ggagaaggag agggaaaggg agagggagag ggagagggag agggagaggg      1320
     agagggagag ggaaagccat attttttaat gttttttaac agctcaacgg ctgggctact      1380
     tcttagcctc cgtgcggcta acacactctt tcaatattcc tgactcacca cttactaaaa      1440
     tcctgggcac cccagaccca gacctgtagc ccttctgggc catgcccccg actcttacac      1500
     agtggttctg tgctcttctg tacctctcac gtctggtttt tactactttc ctggcatggc      1560
     agcccctccc ctgtcccttg cccaagaatc ttaaaagtac tgcctttgtc tccgtaccca      1620
     gccatttgct gctggcaact ttatttacca ataaaaacca acttggggca agga            1674
//


spacer
spacer