Dbfetch

ID   AH005675; SV 2; linear; genomic DNA; STD; MUS; 3866 BP.
XX
AC   AH005675; U90655-U90657;
XX
DT   03-AUG-2016 (Rel. 129, Created)
DT   20-SEP-2016 (Rel. 130, Last updated, Version 2)
XX
DE   Mus musculus strain 129 galanin receptor (Galnr) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3866
RX   DOI; 10.1006/geno.1997.4960.
RX   PUBMED; 9367674.
RA   Jacoby A.S., Webb G.C., Liu M.L., Kofler B., Hort Y.J., Fathi Z.,
RA   Bottema C.D., Shine J., Iismaa T.P.;
RT   "Structural organization of the mouse and human GALR1 galanin receptor
RT   genes (Galnr and GALNR) and chromosomal localization of the mouse gene";
RL   Genomics 45(3):496-508(1997).
XX
RN   [2]
RP   1-3866
RA   Jacoby A.S.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Neurobiology Programme, The Garvan Institute of Medical Research, 384
RL   Victoria St, Sydney, NSW 2010, Australia
XX
DR   MD5; 9e13b131a118b218301dd513397ea09e.
XX
CC   On or before Aug 1, 2016 this sequence version replaced gi:2358263,
CC   gi:2358264, gi:2358265, gi:2358266.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3866
FT                   /organism="Mus musculus"
FT                   /map="18E3-4"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..>3866
FT                   /gene="Galnr"
FT   mRNA            join(396..1704,1926..1991,2383..>3866)
FT                   /gene="Galnr"
FT   exon            396..1704
FT                   /gene="Galnr"
FT                   /number=1
FT   CDS             join(1042..1704,1926..1991,2383..2700)
FT                   /codon_start=1
FT                   /gene="Galnr"
FT                   /product="galanin receptor"
FT                   /protein_id="AAB87748.1"
FT                   /translation="MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFA
FT                   MGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLG
FT                   AFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALS
FT                   IAMASPVAYHQRLFHRDSNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKV
FT                   LNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASF
FT                   FFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTP
FT                   PSTNCTHV"
FT   intron          1705..>1796
FT                   /gene="Galnr"
FT                   /number=1
FT   gap             1797..1896
FT                   /estimated_length=unknown
FT   intron          <1897..1925
FT                   /gene="Galnr"
FT                   /number=1
FT   exon            1926..1991
FT                   /gene="Galnr"
FT                   /number=2
FT   intron          1992..>2092
FT                   /gene="Galnr"
FT                   /number=2
FT   gap             2093..2192
FT                   /estimated_length=unknown
FT   intron          <2193..2382
FT                   /gene="Galnr"
FT                   /number=2
FT   exon            2383..>3866
FT                   /gene="Galnr"
FT                   /number=3
FT   repeat_region   complement(3255..3386)
FT                   /rpt_family="B1"
FT   repeat_region   3456..3527
FT                   /gene="Galnr"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="gggaga"
FT                   /note="hexanucleotide"
FT   regulatory      3842..3849
FT                   /gene="Galnr"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3866 BP; 793 A; 1029 C; 921 G; 923 T; 200 other;
     ggtaaagtgg ctcctgcctc accattgcgc atccttgcct gcagggctgg actgtgcaac        60
     ccgcactggt gcatctccac agagctttcc caacgagcac cctgtcctac ccttctgtgc       120
     acaatctgtt tctggccttg tgtctagcag ttgtggtcac tcaccgctgg aggatcgctg       180
     gcgttttgga aagcgatata gttacccggt acctacatgc aagagcaggt ctttcttttg       240
     gactgctaga agcagtggct catagttggt gtggcccccg cctcccttct cagcagagcg       300
     gcctttcacc acagtcaaat gactcttcac aaacacttca ctcgtcaagg cttccgtttg       360
     tgtcactcag atgagtaatg tctggtggaa atgatggatc cgtgagagag gctcgccctg       420
     cagaggaccc gggactaaga gggagccgca ggccagcgca gcgaggcagg gaggtggatc       480
     ttagtgcggg aagctcagcg accctcttca ccattgaagg tgtgcatcgc tgggctctcg       540
     gacgttcggg aagaagagcg tcaaagcaac aggtgcaacc tcaaggcact gaaagcaagg       600
     ggacgcagct cacaagggcc aagggattga acccataacc gctcagaaga ttctccgcct       660
     gcggagagct gcggaggagt cccacccgtc cagcttgctg actgcgagca gtgagagtcg       720
     cctagacccg tacctctgtg ttctggagcc tgccgccccc gcacgggaaa ggcttagctc       780
     gggacttgca gcaccgcctc ctctttagcc aggccaggca cgaggatagt gtgatcgggc       840
     acagccaggg tcgctcttcc aggctttctt gcgggttgcg ggaggtacta gttggagacg       900
     cgcgcgctcg ctctcgccgc tctgtcctgg gccactccgt gatcctaggc tacctccaga       960
     gccagttttc cctggctggc acaactctcc agggcgctcc ggtccgttgc acagcgcccc      1020
     aagggggtat cccagtaagt gatggaactg gctatggtga acctcagtga agggaatggg      1080
     agcgacccag agccgccagc cccggagtcc aggccgctct tcggcattgg cgtggagaac      1140
     ttcattacgc tggtagtgtt tggcctgatt ttcgcgatgg gcgtgctggg caacagcctg      1200
     gtgatcaccg tgctggcgcg cagcaaacca ggcaagccgc gcagcaccac caacctgttt      1260
     atcctcaatc tgagcatcgc agacctggcc tacctgctct tctgcatccc ttttcaggcc      1320
     accgtgtatg cactgccaac ctgggtgctg ggcgccttca tctgcaagtt tatacactac      1380
     ttcttcaccg tgtccatgct ggtgagcatc ttcaccctgg ccgcgatgtc tgtggatcgc      1440
     tacgtggcca ttgtgcactc gcggcgctcc tcctccctca gggtgtcccg caacgcactg      1500
     ctgggcgtgg gcttcatctg ggcgctgtcc atcgccatgg cctcgccggt ggcctaccac      1560
     cagcgtcttt tccatcggga cagcaaccag accttctgct gggagcagtg gcccaacaag      1620
     ctccacaaga aggcttacgt ggtgtgcact ttcgtctttg ggtaccttct gcccttactg      1680
     ctcatctgct tttgctatgc caaggtgagt gaggagcgct ggccaggctc ctatgcagct      1740
     cttagtgacc ggtgacctga cctggagctt ctggagcttc atgtctccgc gacactnnnn      1800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaacc cgcttcatcc ggttatgttt      1920
     tgcaggtcct taatcatctg cataaaaagc tgaaaaacat gtcaaaaaag tctgaagcat      1980
     ccaagaaaaa ggtaaattca cacacagatg cggttcctgc ccattttcga gagcttagtt      2040
     gattgttgtt ttagattatt ttcacatcca gccacaggtt cgaggaccag ttnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnctggtgtg tctgaagact gttacagtga      2220
     actgcacata taataataag taaattttta aaaaagaaag ttttttaaat aaataaatgc      2280
     tacagaggtg tattttacag cgctgtattc tcctgatata actggtgtat tcctgcagct      2340
     cctgtcccct ctccaaccct cttccattac tctctcttcc agactgcaca gaccgtcctg      2400
     gtggtcgttg tagtatttgg catatcctgg ctgccccatc atgtcgtcca cctctgggct      2460
     gagtttggag ccttcccact gacgccagct tccttcttct tcagaatcac cgcccattgc      2520
     ctggcataca gcaactcctc agtgaacccc atcatatatg cctttctctc agaaaacttc      2580
     cggaaggcgt acaagcaagt gttcaagtgt catgtttgcg atgaatctcc acgcagtgaa      2640
     actaaggaaa acaagagccg gatggacacc ccgccatcca ccaactgcac ccacgtgtga      2700
     aggtttgcgg gagcctcccg acttccagct cccatgtgtg ttagagagag gagggcggag      2760
     cgaattatca agtaacatgg cagcttattc tccacagcaa ttcctatcga tccaactaca      2820
     ttccacagtg gtaaaaggac gttgattgtt cagggaactc gtgggtctac tgaagatcat      2880
     tttccaattt cattttactc tataattgta tatatgagac aaaagaaact tctgtatagt      2940
     ttctagctct caaggaatga aagtcctaca gcactctgca aatgttttga tgcatgcccc      3000
     agccttccct cccagtctgc ctcagtatcc tcgggcttcc gccactcgtg cctcattgtt      3060
     ttttgtttgt ttgtttgttt ttggtatttt gaaatagggt ttctctgtgt agccctggct      3120
     gtcctgaact cactctgtag accaggctgg cctagaactc agaaatctgc ctgcctctgc      3180
     ctcccaagtg ctgggattaa aggtgtgcac caccactgcc cggccctgcc tcattgtttt      3240
     aactgcatgt gggacagtct ctagtgggcc acatcctttt gtgggtggag tctcctgtga      3300
     gctcagatct gctctgttca gaaatacaga atcaaacaga aggggctgct gtagttggcc      3360
     aactaatctc tactcgaatc acccggcgat gctggggtgt tcctcactat tcaccccaat      3420
     gttccaggtt cccgaatgaa atacacacag acagagggag agggagaagg agagggaaag      3480
     ggagagggag agggagaggg agagggagag ggagagggag agggaaagcc atatttttta      3540
     atgtttttta acagctcaac ggctgggcta cttcttagcc tccgtgcggc taacacactc      3600
     tttcaatatt cctgactcac cacttactaa aatcctgggc accccagacc cagacctgta      3660
     gcccttctgg gccatgcccc cgactcttac acagtggttc tgtgctcttc tgtacctctc      3720
     acgtctggtt tttactactt tcctggcatg gcagcccctc ccctgtccct tgcccaagaa      3780
     tcttaaaagt actgcctttg tctccgtacc cagccatttg ctgctggcaa ctttatttac      3840
     caataaaaac caacttgggg caagga                                           3866
//