spacer

EBI Dbfetch

ID   U89906; SV 1; linear; mRNA; STD; MUS; 1515 BP.
XX
AC   U89906;
XX
DT   02-JUN-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus alpha-methylacyl-CoA racemase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1515
RX   PUBMED; 9307041.
RA   Schmitz W., Helander H.M., Hiltunen J.K., Conzelmann E.;
RT   "Molecular cloning of cDNA species for rat and mouse liver
RT   alpha-methylacyl-CoA racemases";
RL   Biochem. J. 326(Pt 3):883-889(1997).
XX
RN   [2]
RP   1-1515
RA   Schmitz W., Helander H.M., Hiltunen J.K., Conzelmann E.;
RT   ;
RL   Submitted (17-FEB-1997) to the INSDC.
RL   Physiologic Chemistry II, Biozentrum, Am Hubland, Wuerzburg D-97074,
RL   Germany
XX
DR   MD5; ed7c32066136e1bb0c7d48da4507ea0e.
DR   Ensembl-Gn; ENSMUSG00000022244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070877; mus_musculus.
DR   EuropePMC; PMC2171269; 16275751.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1515
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             26..1108
FT                   /codon_start=1
FT                   /product="alpha-methylacyl-CoA racemase"
FT                   /function="racemization of 2-methyl-branched fatty acids as
FT                   CoA esters"
FT                   /EC_number="5.1.99.4"
FT                   /note="required for bile acid synthesis and for catabolism
FT                   of branched-chain fatty acids"
FT                   /db_xref="GOA:O09174"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="MGI:MGI:1098273"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09174"
FT                   /protein_id="AAB72146.1"
FT                   /translation="MVLADFGAEVVRVNRLGSTGENFLARGKRSLALDLKRSQGVTVLR
FT                   RMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYARLSGFGQSGIFSKVAGHDINY
FT                   LALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGIVLALFERTRSGRGQIIDSSMV
FT                   EGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTYKTADGEFMAVGAIEPQFYALL
FT                   LKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFEEA
FT                   LHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAKRDPSVGEHTVEVLREYGFSQE
FT                   EILQLHSDRIVESDKLKANL"
XX
SQ   Sequence 1515 BP; 412 A; 370 C; 387 G; 346 T; 0 other;
     catggccccg gggccgttct gcggaatggt cctggcggac ttcggcgccg aggtggtgcg        60
     cgtgaaccgg ctgggctcca cgggcgagaa ttttctggcc cgaggcaagc gctcgctagc       120
     gctggacctg aagcgctctc agggagtcac ggtgttgcgg cgcatgtgcg cacgcgcgga       180
     cgtgttgctg gagcccttcc gctgcggtgt catggagaaa ctccagcttg ggccagagac       240
     tctactgcag gacaatccaa agctcatcta tgccaggctg agcggatttg gccaatcggg       300
     aattttctcc aaagtagctg gccatgacat caactatttg gctttatcag gcgttctgtc       360
     aaagattggc agaagcggtg agaaccccta cccaccgctg aatctcctgg ctgactttgg       420
     cggtggaggc ctcatgtgca cactgggcat tgtgctggct ctctttgaac gcacacgctc       480
     tggccgaggg cagatcatcg attcaagcat ggtggaaggg actgcatact taagttcttt       540
     cctgtggaaa acccagccca tgggtctgtg gaaacagcct cgaggacaaa acatcttaga       600
     tggcggtgca cctttctaca caacctacaa gacggcagac ggggagttca tggctgtagg       660
     tgccatagaa ccccagttct atgcactgct gcttaaagga cttggactcg agtctgagga       720
     actcccctcc cagatgagct cagcagattg gccagagatg aagaagaaat ttgcagatgt       780
     gtttgcaaag aagactaagg cagaatggtg ccagatcttt gacgggacag atgcgtgtgt       840
     gaccccagtg ctgacgtttg aggaggccct ccaccaccag cacaacagag aacgggcctc       900
     cttcatcact gatggggagc agctcccgag cccccgccct gcacctctgc tttccagaac       960
     tcctgccgtc ccatctgcca aaagggaccc ttctgtaggg gagcacaccg tagaagtgct      1020
     tagagagtat ggattcagtc aggaagagat ccttcagctg cactcagata gaatcgttga      1080
     aagtgataag ctaaaagcca atctctgact caggcttata gctcaagaga atctgaaggc      1140
     tgcatctcca ctggggaggg atgcccacaa ttgtgtgtat ggaaatgtgg atgaacagca      1200
     atgaagtcat ccaaatatcc caatcacgat ccaacgaaag gctggttaca ggataacgat      1260
     tgcgccctta cgctgcttat cagaacctct gattgaggaa aatttgtgtg tgtgtactga      1320
     tagtaacttg tggcagcttt ctgcctttca gttcccttgg tgaagtgtat ccatttatta      1380
     aaaccctttt ataaatacaa ctctgatcat atattaaata aactattata actttaataa      1440
     ataaaactct tgttttcctc ctccaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1500
     aaaaaaaaaa aaaaa                                                       1515
//


spacer
spacer