spacer

EBI Dbfetch

ID   U89891; SV 1; linear; mRNA; STD; MUS; 549 BP.
XX
AC   U89891;
XX
DT   27-FEB-1997 (Rel. 51, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus metabotropic glutamate receptor type 1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-549
RA   Watanabe M.;
RT   "Mouse mGluR1";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Watanabe M.;
RT   ;
RL   Submitted (18-FEB-1997) to the INSDC.
RL   Anatomy, Hokkaido University School of Medicine, N15, W7, Kita-ku, Sapporo
RL   060, Japan
XX
DR   MD5; 99fb081420bf0a2632d791e91d980f96.
DR   Ensembl-Gn; ENSMUSG00000019828; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105561; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..549
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>549
FT                   /codon_start=1
FT                   /product="metabotropic glutamate receptor type 1"
FT                   /note="mGluR1"
FT                   /db_xref="GOA:P97772"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001256"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR019588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97772"
FT                   /protein_id="AAB48099.1"
FT                   /translation="TFSDASTKTLYNVEEEDNTPSTHFSPPSSPSMVVHRRGPPVATTP
FT                   PLPPHLSAEETPLFLADSVIPKGLPPPLPQQQQQPPPQPPPQQPKSLMDQLQGVVTNFG
FT                   SGIPDFHAVLAGPGTPGNGLRSLYPPPPPPQHLQMLPLQLSTFREEPISPPGEDDDDDS
FT                   SERFKLLQEFVYEREGNTEE"
XX
SQ   Sequence 549 BP; 112 A; 204 C; 144 G; 89 T; 0 other;
     accttttcag acgccagcac caagaccctt tacaacgtgg aggaagagga caatacccct        60
     tcaactcact tcagccctcc cagcagccct tccatggtgg tgcaccgacg cgggccaccc       120
     gtggccacca cgccacctct gccaccccac cttagcgcag aagagacgcc cttgttcctg       180
     gctgattctg tcatccccaa gggcttgcct cctcctctcc cgcagcagca acagcagccg       240
     ccccctcagc cgcctccgca gcagcccaaa tccctgatgg accagctgca aggcgtggtc       300
     accaactttg gctctgggat tccagacttc cacgcggtgc tggcaggccc ggggacacca       360
     gggaacgggc tgcgctccct gtacccgccc ccgcctccac cgcaacacct gcagatgttg       420
     cccctgcagc tgagcacctt ccgagaggag cccatctccc ctccggggga ggacgacgat       480
     gatgacagca gcgagaggtt caagctcctg caggagttcg tgtatgagcg tgaagggaac       540
     acggaggaa                                                               549
//


spacer
spacer