Dbfetch

ID   U89489; SV 1; linear; mRNA; STD; MUS; 2094 BP.
XX
AC   U89489;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus LIM homeobox protein cofactor CLIM-1b mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2094
RX   PUBMED; 9192866.
RA   Bach I., Carriere C., Ostendorff H.P., Andersen B., Rosenfeld M.G.;
RT   "A family of LIM domain-associated cofactors confer transcriptional
RT   synergism between LIM and Otx homeodomain proteins";
RL   Genes Dev. 11(11):1370-1380(1997).
XX
RN   [2]
RP   1-2094
RA   Bach I.;
RT   ;
RL   Submitted (13-FEB-1997) to the INSDC.
RL   Medicine, University of California, San Diego, 9500 Gilman Drive, La Jolla,
RL   CA 92093, USA
XX
DR   MD5; 4e0cbec00e6ff4e78fb21a3196198817.
DR   Ensembl-Gn; ENSMUSG00000039706; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029498; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029446; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029507; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029961; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028638; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029199; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029345; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029305; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029430; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029333; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029994; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028362; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028719; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000070748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199534; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071552; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071632; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071546; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071567; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071211; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072044; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071750; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071153; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071290; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071198; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071353; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071229; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072242; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071219; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070365; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2094
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             143..1138
FT                   /codon_start=1
FT                   /product="LIM homeobox protein cofactor CLIM-1b"
FT                   /db_xref="GOA:O55203"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="InterPro:IPR030174"
FT                   /db_xref="MGI:MGI:894670"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55203"
FT                   /protein_id="AAB96886.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSGGNTTNSSGS
FT                   KKKTPAASLSLATQVPGLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH"
XX
SQ   Sequence 2094 BP; 594 A; 558 C; 465 G; 477 T; 0 other;
     ggcgtcgaga cgggatgtgt gtctgtgtgt gtgtgagcgt gtgtgcgtgc gtctactttg        60
     ttgtgtgaaa gaacacagcc catgtgctct gcatggacgt tcctgatcct ctattaagct       120
     tgattttcga caagcaggca agatgtccag cacaccacat gaccccttct attcttctcc       180
     tttcggccca ttttatagga gacatacacc atacatggta cagccagagt accgaatcta       240
     tgagatgaac aagagactgc agtctcgtac agaggacagt gacaacctct ggtgggatgc       300
     gtttgccact gaattttttg aagatgatgc cacattaaca ctttcatttt gtttggaaga       360
     cggaccaaag cgatacacta tcggcaggac cctcattccc cgttatttta gcaccgtatt       420
     tgaaggaggg gtgacagacc tgtactacat ccttaaacac tcaaaggagt catatcacaa       480
     ctcatccatc acagtagact gcgaccagtg tgccatggtc acacagcatg ggaagcccat       540
     gtttaccaag gtatgcacag aaggcaggct gatcttggaa ttcacatttg atgacctcat       600
     gagaataaaa acgtggcact ttaccattag acagtacagg gagctggtcc ccagaagcat       660
     actagccatg cacgcacaag atcctcaggt cctggatcag ctgtccaaaa atatcaccag       720
     gatgggtctc acaaacttca ccctcaacta cctcaggttg tgtgtaatac tggagccaat       780
     gcaggaactg atgtcgagac acaaaaccta caacctcagt ccccgagact gcctgaagac       840
     ctgtctgttt cagaagtggc agcgaatggt ggccccgcca gcagaaccca caaggcaacc       900
     gacaaccaaa aggagaaaac gaaaaaactc cacaagcagc acgtccaata gcagtggcgg       960
     gaacacgacc aacagttccg gcagcaagaa gaagaccccg gcggcaagcc tgagcctggc      1020
     cactcaggta cctgggctag gagccatccc gaactgcagc ctcaaccctg ggagggatgg      1080
     agacctgtgt cattcaacag cagtgacccc ttctggccaa tttaaggaga agcattgagg      1140
     ggccctgaaa ggagtcactt ccagtcctcc tcagaggatg tgatggtggt aggagagcca      1200
     actctgatgg gaggtgagtt tggggacgag gacgaaaggc taatcactag attagaaaac      1260
     acgcagtatg atgcggccaa cggcatggac gacgaagaag acttcaacaa ttcacctgcc      1320
     ctggggaaca acagcccgtg gaacagtaaa cctcccgcca cgcaagagac caaatcagaa      1380
     aacgccccac cccaggcttc ccagtaagat gggctactgg cacctgatta cgctgtccat      1440
     aggcccgtgg ggtagaattc cattcgcaaa tctctactat caggagagaa aagagatgaa      1500
     atttaaaaca cacaagcaaa acgtttccat gtaaacatct atttctaaac ttatataatg      1560
     acctgatttt ctttcttgca atttttcccc ctttttaatt gagaggatcg ttcgaatgag      1620
     cctctgtggc ctctccttag aggccttcac aagaagcata gacactgtcc ctgacggtaa      1680
     ttagaagaag cagaggctcc acatctcctg gcacggtctt atctccctcg tgtgttgaac      1740
     ttgctgtccg tccatgcacc ctacgaaggc catgctgtgc aaacgtgctc aggatctcag      1800
     taacgggccg acccccaact acagatgact ttttaatatt gtaaaatatt ttctgctttt      1860
     ttgacttgca tttgaaaatt tcttgtttcc cttcccccag aaaagaaaag aaaaattccg      1920
     ttttgggaaa aataacttaa atgcccctcc cccggccgcc tcccaattcc attggttcca      1980
     tgttggcaca tccccctcca aaaccccggt ctttttaaaa ccccccctca ctccaaacca      2040
     aaatcgggaa aggaaaaaat cccctcccct cctcctaatc cgaaacttta atcc            2094
//