spacer

EBI Dbfetch

ID   U89487; SV 1; linear; mRNA; STD; MUS; 1951 BP.
XX
AC   U89487;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus LIM homeobox protein cofactor CLIM-1a mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1951
RX   PUBMED; 9192866.
RA   Bach I., Carriere C., Ostendorff H.P., Andersen B., Rosenfeld M.G.;
RT   "A family of LIM domain-associated cofactors confer transcriptional
RT   synergism between LIM and Otx homeodomain proteins";
RL   Genes Dev. 11(11):1370-1380(1997).
XX
RN   [2]
RP   1-1951
RA   Bach I.;
RT   ;
RL   Submitted (13-FEB-1997) to the INSDC.
RL   Medicine, University of California, San Diego, 9500 Gilman Drive, La Jolla,
RL   CA 92093, USA
XX
DR   MD5; 6510faaf5531a941cc511a89ea143532.
DR   Ensembl-Gn; ENSMUSG00000039706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070748; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1951
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             143..1264
FT                   /codon_start=1
FT                   /product="LIM homeobox protein cofactor CLIM-1a"
FT                   /db_xref="GOA:O55203"
FT                   /db_xref="InterPro:IPR002691"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="MGI:MGI:894670"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55203"
FT                   /protein_id="AAB96884.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSGGNTTNSSGS
FT                   KKKTPAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDF
FT                   NNSPALGNNSPWNSKPPATQETKSENAPPQASQ"
XX
SQ   Sequence 1951 BP; 559 A; 518 C; 424 G; 450 T; 0 other;
     ggcgtcgaga cgggatgtgt gtctgtgtgt gtgtgagcgt gtgtgcgtgc gtctactttg        60
     ttgtgtgaaa gaacacagcc catgtgctct gcatggacgt tcctgatcct ctattaagct       120
     tgattttcga caagcaggca agatgtccag cacaccacat gaccccttct attcttctcc       180
     tttcggccca ttttatagga gacatacacc atacatggta cagccagagt accgaatcta       240
     tgagatgaac aagagactgc agtctcgtac agaggacagt gacaacctct ggtgggatgc       300
     gtttgccact gaattttttg aagatgatgc cacattaaca ctttcatttt gtttggaaga       360
     cggaccaaag cgatacacta tcggcaggac cctcattccc cgttatttta gcaccgtatt       420
     tgaaggaggg gtgacagacc tgtactacat ccttaaacac tcaaaggagt catatcacaa       480
     ctcatccatc acagtagact gcgaccagtg tgccatggtc acacagcatg ggaagcccat       540
     gtttaccaag gtatgcacag aaggcaggct gatcttggaa ttcacatttg atgacctcat       600
     gagaataaaa acgtggcact ttaccattag acagtacagg gagctggtcc ccagaagcat       660
     actagccatg cacgcacaag atcctcaggt cctggatcag ctgtccaaaa atatcaccag       720
     gatgggtctc acaaacttca ccctcaacta cctcaggttg tgtgtaatac tggagccaat       780
     gcaggaactg atgtcgagac acaaaaccta caacctcagt ccccgagact gcctgaagac       840
     ctgtctgttt cagaagtggc agcgaatggt ggccccgcca gcagaaccca caaggcaacc       900
     gacaaccaaa aggagaaaac gaaaaaactc cacaagcagc acgtccaata gcagtggcgg       960
     gaacacgacc aacagttccg gcagcaagaa gaagaccccg gcggcaagcc tgagcctggc      1020
     cactcaggta cctgatgtga tggtggtagg agagccaact ctgatgggag gtgagtttgg      1080
     ggacgaggac gaaaggctaa tcactagatt agaaaacacg cagtatgatg cggccaacgg      1140
     catggacgac gaagaagact tcaacaattc acctgccctg gggaacaaca gcccgtggaa      1200
     cagtaaacct cccgccacgc aagagaccaa atcagaaaac gccccacccc aggcttccca      1260
     gtaagatggg ctactggcac ctgattacgc tgtccatagg cccgtggggt agaattccat      1320
     tcgcaaatct ctactatcag gagagaaaag agatgaaatt taaaacacac aagcaaaacg      1380
     tttccatgta aacatctatt tctaaactta tataatgacc tgattttctt tcttgcaatt      1440
     tttccccctt tttaattgag aggatcgttc gaatgagcct ctgtggcctc tccttagagg      1500
     ccttcacaag aagcatagac actgtccctg acggtaatta gaagaagcag aggctccaca      1560
     tctcctggca cggtcttatc tccctcgtgt gttgaacttg ctgtccgtcc atgcacccta      1620
     cgaaggccat gctgtgcaaa cgtgctcagg atctcagtaa cgggccgacc cccaactaca      1680
     gatgactttt taatattgta aaatattttc tgcttttttg acttgcattt gaaaatttct      1740
     tgtttccctt cccccagaaa agaaaagaaa aattccgttt tgggaaaaat aacttaaatg      1800
     cccctccccc ggccgcctcc caattccatt ggttccatgt tggcacatcc ccctccaaaa      1860
     ccccggtctt tttaaaaccc cccctcactc caaaccaaaa tcgggaaagg aaaaaatccc      1920
     ctcccctcct cctaatccga aactttaatc c                                     1951
//


spacer
spacer