Dbfetch

ID   U89429; SV 1; linear; mRNA; STD; MUS; 505 BP.
XX
AC   U89429;
XX
DT   24-SEP-1998 (Rel. 57, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus strain BALB/c Fig1 protein (Fig1) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-505
RX   DOI; 10.1016/S0161-5890(98)00031-5.
RX   PUBMED; 9798653.
RA   Chu C.C., Paul W.E.;
RT   "Expressed genes in interleukin-4 treated B cells identified by cDNA
RT   representational difference analysis";
RL   Mol. Immunol. 35(8):487-502(1998).
XX
RN   [2]
RP   1-505
RA   Chu C.C., Paul W.E.;
RT   ;
RL   Submitted (13-FEB-1997) to the INSDC.
RL   Lab. of Immunology, NIAID, Building 10, Room 11N311, Bethesda, MD
RL   20892-1892, USA
XX
DR   MD5; a77213a76f228149fae3c5b4a19b6960.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..505
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="between Klk1 and Ldh3"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /clone="20-8T#22"
FT                   /cell_type="B cells treated with LPS and IL-4 for 12 and 36
FT                   hours"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>505
FT                   /codon_start=2
FT                   /gene="Fig1"
FT                   /product="Fig1 protein"
FT                   /note="similar to some flavoproteins, most specifically to
FT                   monoamine oxidases; interleukin-4 induced gene-1"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAC36535.1"
FT                   /translation="ILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPEKLG
FT                   YNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSRPAV
FT                   QLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALLLNA
FT                   PVVSI"
XX
SQ   Sequence 505 BP; 121 A; 138 C; 146 G; 100 T; 0 other;
     gatcttgcac aagctctgca ggaccctggg cctcaacctg actcagttca cacagtatga        60
     tgagaacacg tggacggagg tgcataatgt gaagctgcga aactatgtgg tggagaagat       120
     gccagaaaag ctgggctaca acctgaacaa cagggaaagg ggccattccc cagaggacat       180
     ctaccagatg gcactcaaca aggccttcaa agacctcaag gccttgggct gcaagaaagc       240
     catgaataag ttcaacaagc atacgcttct ggaatacctc ctcgaggagg gtaacctgtc       300
     ccggccggct gtgcagctcc tgggagatgt gatgtccgag gagggcttct tctacctcag       360
     ctttgcagaa gccttacgtg cgcacgcctg cctgagcgat agactccggt acagccgcat       420
     cgtaggtggc tgggacctgc ttccgcgagc tctgctgagc tcactgtccg gggcgctgct       480
     actgaacgcg cctgtggtgt cgatc                                             505
//